KEGG   Falco peregrinus (peregrine falcon): 101920316Help
Entry
101920316         CDS       T02856                                 

Gene name
ABHD12
Definition
(RefSeq) abhydrolase domain containing 12
  KO
K13704  abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fpg01002]
    101920316 (ABHD12)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpg04147]
    101920316 (ABHD12)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101920316 (ABHD12)
Peptidases [BR:fpg01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   101920316 (ABHD12)
Exosome [BR:fpg04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   101920316 (ABHD12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 Abhydrolase_6 Abhydrolase_3 Thioesterase Peptidase_S9 Peptidase_S15 Abhydrolase_2 Say1_Mug180
Motif
Other DBs
NCBI-GeneID: 101920316
NCBI-ProteinID: XP_013158785
Position
Un
AA seq 363 aa AA seqDB search
MEAGFDRQEDSPFPVTALEIMPKTYPGLKRYGLWFRLRKLIIWLLGVYIAIPFLVKLCPA
IQAKLVFLNFVRVPYFIDLKRPQDQGLNHTCNYYLQPEEDVTIGVWHTVPAALWKNARGK
DQLWFEDALGSSHPVILYLHGNAGTRGGDHRVELYKVLSSLGYHVVTFDYRGWGDSIGSP
SERGMTYDALHVFDWIKARSGDNPVYVWGHSLGTGVATNLVRRLCERETPPDALILESPF
TNIREEARSHPFSVIYRYFPGFDWFFLDPITTSGIKFANDENVKYISCSLLILHAEDDPV
VPFQLGKKLYNIAATSRSFRDYKVQFVPFHTDLGYRHKYIYRSPELPRILREFLGKSEHE
HHH
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atggaggcaggttttgacagacaagaggatagcccattccctgtgactgctctagaaatc
atgccaaaaacttacccaggtttaaagcgatatggattatggtttcggttgcggaagtta
ataatctggttgctgggagtgtacatagccattccatttctagtaaaactttgccctgct
attcaggcaaagctggtcttcctaaactttgtgagggtcccatatttcattgacttgaaa
agaccacaggatcaaggtttaaaccacacctgtaattattatctgcagccagaggaggat
gtaaccattggagtgtggcatacggtccctgcagccttatggaagaatgcccgagggaag
gaccagttgtggtttgaagatgctttgggttccagccatcctgtaatcctttacttgcac
ggcaatgcgggaacaagaggaggggatcaccgcgtggagctttacaaggttctcagctcc
ctcgggtaccatgtggtcacgtttgattatcgaggctggggtgattcgataggcagcccg
tcagagaggggaatgacctacgacgcccttcatgtctttgactggataaaagcaagaagt
ggagacaaccctgtctatgtatggggacactccttgggcacaggggttgcaacaaatctc
gtgaggcgcctttgtgagagagaaacgcccccggatgccctgatcctggaatctccattc
acgaacatacgggaggaggcgcgaagtcaccccttttctgtgatatacagatacttccct
ggctttgactggttcttccttgaccccatcacgacaagtggaattaaatttgcaaatgat
gagaatgtgaaatacatttcatgctccctactcatccttcatgctgaggatgacccagtg
gtaccatttcagctgggaaagaagctttacaacattgctgcaacgtcacggagtttccga
gactacaaggtgcagtttgttccattccacacagaccttggctaccggcacaagtacatc
tacaggagtccagagctacctcgaatactgcgggaattcctcggaaaatctgaacatgag
catcatcactga

DBGET integrated database retrieval system