KEGG   Falco peregrinus (peregrine falcon): 101920576Help
Entry
101920576         CDS       T02856                                 

Gene name
SCD5
Definition
(RefSeq) stearoyl-CoA desaturase 5
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg01040  Biosynthesis of unsaturated fatty acids
fpg01212  Fatty acid metabolism
fpg03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    101920576 (SCD5)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    101920576 (SCD5)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     101920576 (SCD5)
Lipid biosynthesis proteins [BR:fpg01004]
 Desaturase
  First
   101920576 (SCD5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase
Motif
Other DBs
NCBI-GeneID: 101920576
NCBI-ProteinID: XP_013159540
Position
Un
AA seq 259 aa AA seqDB search
MQIEDNTYFCFLMTALGVTAGAHRLWSHRSYKAKLPLRIFLAAANSMAFQNDIYEWSRDH
RVHHKYSETDADPHNARRGFFFAHIGWLFVRKHRDVIEKGRKLDFTDLLDDPVVRFQRKY
YKSSVVLMCFVIPTFVPWYLWGESLWNAYFLASILRYTISLNVTWLVNSAAHMYGNRPYD
KYISPRQNTFVTVGAIGEGFHNYHHTFPFDYSASELGLKFNPTTWFIDFMFWLGLVTDRR
QAPKDMIEARKERTGDGSA
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaggacaacacgtatttctgtttcctgatgacggcgctgggcgtgacagct
ggtgcgcatcgcctgtggagccaccgttcctacaaagccaagctgcctttgcggatcttt
ctggctgcagctaactccatggctttccagaacgacatctacgagtggagcagagaccac
cgtgtgcatcacaagtactctgagacggacgcggacccacacaatgcccgccggggcttc
ttcttcgcccacatcggctggctgtttgtgcgcaagcatcgggatgtcatagagaagggg
aggaaactggatttcactgacctgctggatgaccctgttgtcaggttccaaagaaagtac
tacaagagttcagttgtgctgatgtgctttgtgatccctacttttgtgccgtggtacctc
tggggcgagagtctgtggaacgcgtacttccttgcctccattctccggtacaccatctcc
ctcaacgtcacctggctggtcaacagcgccgctcacatgtacgggaaccgcccctacgac
aagtacatcagccccaggcagaacacctttgtcactgtgggagccattggtgagggtttc
cacaactaccaccacaccttcccattcgactactcagccagcgagctgggcctgaagttt
aaccccaccacctggttcattgacttcatgttttggttggggttggtcactgaccgcagg
caggctccgaaggatatgatcgaggctcgcaaagaaaggactggagatggcagtgcttga

DBGET integrated database retrieval system