KEGG   Falco peregrinus (peregrine falcon): 101920979Help
Entry
101920979         CDS       T02856                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00230  Purine metabolism
fpg01100  Metabolic pathways
fpg04270  Vascular smooth muscle contraction
fpg04540  Gap junction
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101920979
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101920979
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101920979
Enzymes [BR:fpg01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     101920979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 101920979
NCBI-ProteinID: XP_013150563
Position
Un
AA seq 789 aa AA seqDB search
MLVYLLLQYGFINTCLKSLVVEKYGEETWERLRLQAGVQDSFLTFEVYKDEITMQLIDKA
CKILGVPADAVLREFGEYFFEFCKRSGYDHMLRTLGGNLYEFIENLDALHSYLSLSYQEM
NAPSFRVEKNEDGSMHLHYYSDRRGLCHIVPGIIGAAALDFFNIEISMEIVNQTEEEEEE
RTGKKEHIVFLVTQNPVFSYKERNEFCSSPQYLADSVKQIENQLNKEDLEKAKNTIRDRG
SSVCPVKKSHWKTIRGIITLGKGKLLRGFDPVYPKSLWIDTKTFCNGLPFHMVFDKELRV
KQAGVSIQKIVPGLQTMGICLDHYFSILHPEVPFTISSIQKFINSQFVFQTRREMMPESW
KQRPMLELRGQMIWMESLQCMLYLCSPLLRTLHELEERQMHIADIAPHDVTRDLILLNQQ
RLAEMELSNQLERKKEELRILSKHLEEEKKKTEALLYAMLPQHVANQLKEGKRVEAGEFK
ECTILFSDVVTFTNICAQCEPIQIVLMLNSMYLRFDRLTTVHDVYKVETIGDAYMVVGGV
PVPVPTHAERVANFALGMIIAAKGVQNPVSGNPIQIRVGIHTGPVLAGVVGEKMPRYCLF
GDTVNIASRMESHGVPSKIHLSSSAYQCLKYKNFEMTERGEIEVKGKGKMHTYFLIRNKT
ATENEIMGRPVKDLDSGHESVQSFQEGRAETIPSCHQPVTQTQPEKDQTPAIAMKYTDGP
TDAQNSLERRNQAKIADLTGKTYDSKSDGSLHGNQQADDSPCPLNQGRVKPATEEPQNRN
VRSNFCTLL
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgttggtgtatttgcttttacagtatggatttataaatacatgcctgaagtctttggtg
gttgaaaagtatggtgaagaaacgtgggaaagattaaggctgcaggctggagtccaggat
tctttcttgacttttgaggtttacaaagatgagatcacaatgcagctcattgacaaagcc
tgcaaaatattaggtgttcccgccgacgcggttctgagagagtttggagagtatttcttt
gagttctgtaaacgctcaggctatgaccacatgctgaggacactgggtgggaatctctat
gagttcatagagaacctggacgcattgcacagctacctctccctttcctaccaggagatg
aatgcaccatcttttcgagtagagaagaatgaagacgggtcaatgcatttacattactat
tcagacagaagaggtctgtgccatattgtgccaggaatcatcggtgcagcagccttggat
ttttttaacattgagatttcaatggaaatagtcaatcaaacagaagaagaagaagaagaa
agaactgggaaaaaggaacatattgtttttcttgtcactcaaaaccctgtattttcatac
aaggaaagaaatgagttttgttcctcacctcaatatcttgctgactctgtaaaacaaatt
gagaaccaacttaataaagaggatcttgaaaaagccaagaatacaattagagacagagga
agctctgtttgtcctgtgaagaagagtcactggaaaacaataagaggaataatcacatta
ggaaaaggtaagctcctgagaggatttgatcctgtttatcccaagagcctctggattgac
acaaaaacattttgcaatggacttccttttcatatggtttttgacaaagagctcagagtg
aagcaagctggggtgagcattcagaagattgtacctggcctccagaccatgggcatctgc
ttggatcactatttcagtatccttcacccagaagtacccttcaccatctctagcattcag
aaattcatcaacagccaatttgttttccagactagaagagagatgatgccagagtcttgg
aaacaacggccaatgctagagctgagaggccagatgatctggatggagtccctgcagtgc
atgctctatctctgctcacctttgcttcgcactttgcatgagctggaggagcgacagatg
catattgcagacattgcacctcacgacgtgaccagggatttgattcttctcaatcagcag
cgtctggcagagatggagctctccaaccagctggagaggaagaaggaagaactgcggata
ctgtcgaagcacctggaggaagagaagaaaaagaccgaagctctgctctacgccatgctt
ccacagcatgtggccaaccagctgaaagaggggaagcgagttgaggcaggagagttcaag
gagtgcactatattgttcagtgatgttgtgaccttcaccaacatttgtgcccaatgtgag
cctattcagatagttctcatgttgaattcaatgtacctgcgatttgacagactgaccacg
gtgcatgacgtgtacaaggtggagacaattggagatgcctacatggtagtaggtggggtc
cctgtgcctgtacccactcatgctgagcgcgtcgctaactttgccttgggaatgataata
gcagctaaaggagtacagaacccagtttctggaaatcctatccaaattagagttgggatc
catacaggtcctgtcttggctggagttgttggagaaaagatgcctcgttattgcttattt
ggagacacggtgaatatagcttcccggatggagagtcatggtgtcccaagtaaaattcat
ctcagctccagtgcctatcaatgcctgaaatacaagaattttgagatgactgaaagagga
gaaatagaagtaaaaggcaaagggaaaatgcacacatacttcctcataagaaataaaact
gcaactgagaatgagattatgggaaggccagtgaaagacctagattctggccatgaatct
gttcagtcctttcaagaaggcagggctgaaacaataccaagttgtcatcagccagttact
cagactcagccagagaaggaccagaccccagccattgcaatgaagtatactgatggcccc
acagatgcacaaaacagcctcgaaagaagaaatcaagcgaaaattgcagatttaacaggc
aaaacttatgattccaaaagtgatgggagtctccatggcaaccagcaggcagatgatagt
ccttgtcctctaaaccagggaagagtcaaacctgctactgaagagccacagaacagaaac
gttcgctctaatttttgcactttactctaa

DBGET integrated database retrieval system