KEGG   Falco peregrinus (peregrine falcon): 101922011Help
Entry
101922011         CDS       T02856                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    101922011
Enzymes [BR:fpg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     101922011
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 101922011
NCBI-ProteinID: XP_005235300
Position
Un
AA seq 493 aa AA seqDB search
MVYLTLQKTQKFLASSRQVHKTAAHVVARSAPEETVTSSFASFIHAVRPEHLSKTVRHRS
KRMILDSIGVGLVGSTTHVFDIALQYCRELYSSVAVSSVYGKPGIKLSPTLAAFTNGVAT
HSMDFDDTWHPATHPSGAVLPALLAASQMLPPSTKPNGMDFLLAFNVGLEVQGRLMHFST
EAHNIPKRFHPPSVVGTLGSAAATAKLLALSTAQCAHALGIAASLAGAPMANAATQAKPL
HIGNATRLGFEAALLAARGMEANPLILDDIPGCSGFSAFYSVYQPKPLSTPSDHHEFLLE
KQDIAFKRFPAHLGMHWVVDAALSVRNLFINYAGSFSPSLIRTIVLKIPVSKYINRPFPS
SEHQARHSFQFNACTALLDGEVGLSSFTESSIHRQELRELLDKVVVEHPEDNVANFDKMY
GEVALLLHSGDVLTGKCDTFYGHWRKPLSKESLLKKFRSNASHVLQEEKIETIITMVDNL
ENLSDSSQLACSL
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtctacttaaccttacagaaaacccagaagttcttggcaagctcccggcaagttcac
aaaactgctgctcacgtggtggccaggagtgctccagaggagaccgtgaccagcagcttt
gcctccttcatccatgcagttcgacctgagcacttgtctaagactgtccgtcaccggagc
aagaggatgatccttgatagcattggggttggccttgtgggcagcacgacgcatgtgttt
gatatcgctctgcagtactgccgggagctgtactcttcagttgccgtgagctctgtctat
ggcaagccaggcataaagctctctcccacgctggctgcgttcaccaatggagttgcgact
cactccatggacttcgatgacacctggcaccctgctactcacccatcaggggctgttctg
ccggctcttctggcagcttcccagatgctacctccaagcaccaaacccaatggcatggat
ttcctgctggcatttaatgtgggcctggaagtgcaaggaaggctcatgcatttctccact
gaggctcacaacatcccaaaaaggttccaccctccctcagtggtcggtaccttgggcagt
gctgcggccactgcaaaactgctcgccctcagcacagcccagtgcgcacatgctttgggc
attgctgcatcgcttgccggggcgcccatggcaaacgctgccacccaagccaagccatta
catatcggaaatgccacccgcctgggcttcgaagcagcactgctggctgctcgagggatg
gaggctaaccccttaattctggatgatatccctggttgctctgggttcagtgctttctac
agtgtctatcaacccaaaccactgtccacaccaagcgatcaccatgagttcctcttggag
aagcaggatattgctttcaagcgattcccagcccacttggggatgcactgggtggtggat
gctgccttgtctgtccggaatctcttcatcaactatgcagggtccttctctccttctttg
atccgcaccattgtgctgaagatcccagtgtcgaagtacatcaatcggcctttccccagc
tctgaacaccaggctagacactccttccagttcaacgcctgtactgccctattggatggc
gaagtaggtctcagctccttcacagagagcagcatccaccggcaggagctaagggagctg
ctggacaaagtggtggtggagcaccctgaagataatgtggccaactttgacaagatgtac
ggagaggtggcactgcttctgcacagcggggatgtcctgacaggcaaatgtgacaccttc
tatgggcactggaggaagcctctgagcaaagaatcgctcctgaaaaagtttcgatccaac
gcttctcatgtgcttcaagaagaaaaaatagaaaccatcatcactatggtggacaacctg
gagaatctgtcagatagttcccagctggcctgcagcctgtga

DBGET integrated database retrieval system