KEGG   Falco peregrinus (peregrine falcon): 101922643Help
Entry
101922643         CDS       T02856                                 

Gene name
PLA2G4B
Definition
(RefSeq) cytosolic phospholipase A2 beta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00564  Glycerophospholipid metabolism
fpg00565  Ether lipid metabolism
fpg00590  Arachidonic acid metabolism
fpg00591  Linoleic acid metabolism
fpg00592  alpha-Linolenic acid metabolism
fpg01100  Metabolic pathways
fpg04010  MAPK signaling pathway
fpg04217  Necroptosis
fpg04270  Vascular smooth muscle contraction
fpg04370  VEGF signaling pathway
fpg04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101922643 (PLA2G4B)
   00565 Ether lipid metabolism
    101922643 (PLA2G4B)
   00590 Arachidonic acid metabolism
    101922643 (PLA2G4B)
   00591 Linoleic acid metabolism
    101922643 (PLA2G4B)
   00592 alpha-Linolenic acid metabolism
    101922643 (PLA2G4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101922643 (PLA2G4B)
   04370 VEGF signaling pathway
    101922643 (PLA2G4B)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101922643 (PLA2G4B)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    101922643 (PLA2G4B)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101922643 (PLA2G4B)
Enzymes [BR:fpg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101922643 (PLA2G4B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cupin_8 PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 101922643
NCBI-ProteinID: XP_013149975
Position
Un
AA seq 947 aa AA seqDB search
MMVREVLGRWPWLSGAVCRAELGWPQSVPCLDGAPSPLEFYRGWVAPNKPCVIRNALGHW
PALERWAPAYLREVVGPKVVSVAVTPNGYADAVFQDRFVMPEERRMPFTDFLDIVEKKVT
SPNVFYVQKQCSNLTEEFPELVCDVQPDIPWMSEALGRKPDAVNFWLGESAAVTSLHKDH
YENLYCVISGKKHFLLHPPSDRPFIPYELYQPATYQVSEDGSFEIVDDKNADKMKFCPIH
MLSVRIIQAKNIKSRDLLTASDCYVRLWLPSASNGKLQTKTIKNSDNPVWNETFYFRIQR
EVENILELAVCDEDPLTKDDTQFTVLFNVARIRPGETLRETFALKSEKERCTKKWESLEV
EFWIERIPGPPERLITNDVLVSREVCCLDVRVDINESRKYLQENLDVRFGYNLCQEEQEF
LQKRKRVVASALKRVLHLERDLHGHEVPVIAVMATGGGLRAMSAMFGHLLALQKLNLLDC
VTYLTGASGSTWTLADLYEHADWSQRTLEGPLKAVKEQVTKCKRNLMSVEHLKYYHKELA
ERAKAGHVSSFTTLWSLVQEMFLHERPRKYKLTDQRKALEHGQNPLPFYAVLNVKEEKFS
TFKFREWAEFSPYEVAIPKYGASIRSEYFDSEFFMGRRVKKLPESRICYLEGLWTNIFTR
NLLDGLYWSSNSNEFWERWAKDMVDIEKHSPEDDVTVIEPPSCLSGKLYEMFQDIMTKRP
LLGKSHNFLRGLEFHKDYIHQKKFIEWKDTVLDAFPNNLTPLQKYLCLIDVGYFINTSGA
ALFKPERNVDVIISLDYGLGNVFKQLEMTYKYCKIQNIPFPKVELSKEEEENPKECYVFS
DAEDPRAPIVIHFPLVNDTFKEFKEPGVKRCHSEIEEGKVNLENNCSPYYLIRLIYSSEN
FDKLVNLSKYNILNNKDLLLQALRSAVERRRSSRTGNLPGHSGAGYP
NT seq 2844 nt NT seq  +upstreamnt  +downstreamnt
atgatggtgagagaagtgttgggccgctggccgtggctgagcggagccgtttgccgcgca
gagctggggtggccgcagtccgtgccttgccttgacggggccccgtccccgctggagttc
taccgcgggtgggtggccccgaacaagccctgcgtgatccgcaacgccctcgggcactgg
ccggcgctggagcggtgggcgccggcctacctcagggaggtagtaggtcccaaggtggtg
tctgtggcagtaacaccaaatggttatgcagatgcagtgtttcaggacaggtttgtcatg
ccagaggagcgccgaatgccgttcacggactttttggacattgtcgagaagaaagtgacc
tctcccaacgtattctatgtgcagaagcagtgttcaaacctcactgaggagtttcctgaa
cttgtttgtgatgtgcagcctgacataccgtggatgagcgaggcacttgggaggaagcct
gatgctgtgaatttctggcttggggaatcggctgctgtgacatctttacataaggatcat
tatgagaacttgtactgtgtgatatctggaaagaagcatttcctactgcatccaccgagt
gaccgtcccttcatcccctatgagctctatcagccagcaacctaccaggtatcagaagat
gggtcatttgaaattgtggatgacaagaacgcagataagatgaagttttgccccatccac
atgctttctgtaagaatcatacaagctaagaacatcaagtcaagagacctgttgaccgca
tcagactgctacgtgcgcttgtggctgccgtctgcttcaaatggaaagcttcagaccaaa
accatcaagaattctgacaaccctgtctggaatgagactttctactttaggatccagaga
gaagttgagaacattttagagttggcagtgtgtgatgaagatccactcaccaaagatgac
acacagttcacagttctttttaatgttgctagaatcagacctggagagacgctccgtgag
acatttgctttgaaatcagagaaagagaggtgcactaagaaatgggagagtttggaagtg
gaattctggatagaaagaatccctggccctccagagcgtctcattaccaatgatgtccta
gtgtcccgtgaggtttgttgcttggatgtgcgagtggacattaatgaaagcaggaaatat
ttgcaagaaaatctagatgtgcgcttcgggtacaatctgtgccaagaagagcaagaattc
ctgcaaaaaaggaagagagtggttgccagtgccctgaaaagggttcttcatctggaaaga
gatctgcatggacacgaggtcccggtaatagctgttatggcaacaggcggaggcctcaga
gcaatgtcagctatgtttggccacctcttagctcttcagaagctaaatctgttggactgt
gttacctatctcaccggggcttctggctcaacatggaccctagcagatctgtatgagcat
gctgactggtcacagaggactctggaggggccacttaaggcagtaaaagaacaagtgaca
aaatgcaagcgcaaccttatgtctgtagagcatctgaagtactatcacaaggaactcgct
gaaagggcaaaagcaggacatgtgtcatcttttacaactctgtggtcacttgttcaggaa
atgttcttacatgaacggccaagaaagtacaaactcacagaccagcgcaaggcattggag
catggacaaaacccattgcctttctatgcagtcctcaatgtgaaagaggaaaagttcagt
actttcaaatttagagagtgggcagagttctctccttatgaggtagccataccaaaatac
ggagcctccattcgttcagaatattttgacagtgagttcttcatgggaaggcgagtgaag
aagctgccagaatctcggatctgctatctggaaggtctttggacaaacatctttactagg
aacttgctcgatggcttgtactggtcctcaaattcaaatgaattctgggaacgatgggcc
aaagatatggtagatatagaaaagcattcccctgaggatgatgtcactgtcatcgagcct
ccgtcttgtttgtcagggaagttgtatgaaatgtttcaggacattatgactaagcgtcca
ctactgggaaaatctcataacttcctgagaggcttagaatttcataaggattatatccat
cagaaaaaatttattgaatggaaagacactgtgctggatgctttccctaacaatctgaca
ccactgcagaaatatctttgcctgatagatgttggctatttcatcaacaccagtggtgca
gcccttttcaagccagagaggaatgtagacgtcattatctcacttgattatggtctgggg
aatgtgttcaagcaattggagatgacgtacaaatattgcaagatacaaaatatcccattc
cccaaagtggagctaagtaaagaagaggaggagaacccaaaggaatgttacgtgttttcg
gatgcagaggaccccagagcacccatagtaatccattttcccctggtgaatgacaccttt
aaggaattcaaggagcccggggtaaagcgctgtcactcagagattgaagaaggcaaagtg
aatctggagaacaactgctcaccctactacctcattaggctaatctactcctctgaaaat
tttgacaaacttgtgaacctgagcaaatacaacatcctcaataacaaagacctgctcctc
caggcactccggagtgccgtagaacggaggagaagcagcaggactgggaatctccctggc
cattctggagccggatacccctag

DBGET integrated database retrieval system