KEGG   Falco peregrinus (peregrine falcon): 101922968Help
Entry
101922968         CDS       T02856                                 

Gene name
DOCK7
Definition
(RefSeq) dedicator of cytokinesis 7
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
fpg  Falco peregrinus (peregrine falcon)
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fpg04131]
    101922968 (DOCK7)
Membrane trafficking [BR:fpg04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    101922968 (DOCK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N TEA
Motif
Other DBs
NCBI-GeneID: 101922968
NCBI-ProteinID: XP_013157939
Position
Un
AA seq 2199 aa AA seqDB search
MSHPFVEFTVHGGCACGRTRVVCNEVSTLIAPQVHNEEQGCCISNSFFYAYLXDCCVSLW
DFPYWSLSCFRTVAAEVRKQISGQYGGSPQLLKNLNIGGSVSHHTTVPLTEAVDPVELED
YLITHPIAVESGPLRDLLEFPSDDIEVVYTPRECRTLVSAVPEESEMDPHVRDCVRSYTE
DWAIVNRKYHKLGTGFNPNTLDKQKERQKGLPKQIFESDEAPDGNSYQDEQDDLKRRSMS
IDDTPRGSWACSIFDLKNSLPDALLPNLLDRTPNEEIDHHNEDQRKSSRHKELFALHPAP
DEEEPIERLSVPEVPKEHFGQRLLVKCLSLKFEIEIEPIFASLALYDVKEKKKISENFYF
DLNSEQMKGMLRPHVPPAAISTLARSAIFSITYPSQDVFLVIKLEKVLQQGDIGECAEPY
MIFKESDAAKNKEKLEKLKCQAEQFCQRLGKYRMPFAWTAIHLMNIVSSAGSLERDSTEV
EVGTGERKGSWSERRNSSIVGRRSLERTTSGDEACNLTSFRPATLTVTNFFKQEGDRLSD
EDLYKFLADMRRPSSVLRRLRPITAQLKIDISPAPENPHYCLTPELLQVKLYPDSRVRPT
REILEFPARDVYVPNTTYRNLLYVYPQSLNFANRQGSARNITVKVQFMYGEDPSNAMPVI
FGKSSCPEFSKEAYTAVVYHNRSPDFHEEIKIKLPATLTDHHHLLFTFYHVSCQQKQNTP
LETPVGYTWIPMLQNGRLKTGQFCLPVSLEKPPQAYSVLSPEVPLPGMKWVDNHKGVFNV
EVVAVSSLHTQDPYLDKFFALVHALDEHMFPVRIGDMRIMENNLENELKSSISALNSSQL
EPVVRFLHLLLDKLILLVVRPPVIAGQIVNLGQASFEAMASIINRLHKNLDGNQDQHGRN
SLLASYIYYVFRLPNTYPNSPSPGPGGLGGSVHYATMARSAVRPASLNLTRSRSLSNSNP
DISGTPTSPDDEVRSIIGSKGLDRSNSWVNTGGPKAAPWGSNPSPSAESTQATDRSCNRM
SSHTETSSFLQTLTGRLPTKKLFHEELALQWVVCSGSVREAALQQAWFFFELMVKSMVHH
LYFADKLDAPRKNRFPERFMDDVTALVSTIAGDIVSRFQKDTEMVERLNTSLAFFLNDLL
SIMDRGFVFALIKTCYKQVSSKLYSLTNPSNLASLRLDFLRIICSHEHYVTLNLPCSLLT
PPASPSPSVSSATSQSSGFSTNVQDQKIANMFELSVPFRQQHYLAGLVLTELAVILDPDA
EGLFGLHKKVINMVHNLLSSHDSDPRYADPQVKARVAMLYLPLIGVIMETVPQLYDFTES
HNQRGRPSCVAVDDYESEGGSMISQTVAMAIAGTSVPQLTRPSSFLLTSSSGRQHSTFST
ESSRSLLICLLWVLKNADESVLQKWFTDLSVLQLNRLLDLLYLCVSCFEYKGKKVFERMN
SLTFKKSKDMRAKLEEAILGSIGARQEMVRRSRGQLERSPSGSAFGSQENLRWRKDMTHW
RQNTEKLDKSHKPARSRAEIEHEALIDGNLATEANLIILDTLEIVVQTVSVTESKESILG
GVLKVLLHSMACNQSALYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSSI
STIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEEYLRRSLKTILT
YAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQEDPEMLIDLMYRIAKGYQNSPD
LRLTWLQNMAGKHSERSNHAESAQCLVHSAALVAEYLSMLEDRKYLPVGCVTFQNISSNV
LEESAVSDDVVSPDEEGICSGKYFTEAGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIH
EANRDAKKLSTIHGKLQEAFSKIVHQSTGWEDGKRMFGTYFRVGFYGTKFGDLDEQEFVY
KEPAITKLAEISHRLEGFYGERFGEDVLEVIKDSNPVDKCKLDPNKAYIQITYVEPYFDT
YEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTILTTSHAFPYIKTRINV
IHKEEIILTPIEVAIEDMQKKTQELAFATHQDPADPKMLQMVLQGSVGTTVNQGPLEVAQ
VFLSEIPNDPKLFRHHNKLRLCFKDFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLK
EALQPLINRKIPQLYKAVLPVTCHRWIFDFTLSAEIRRV
NT seq 6600 nt NT seq  +upstreamnt  +downstreamnt
atgtcacatccatttgtggagtttactgttcatggaggctgtgcctgtggaaggacccgg
gtggtctgcaatgaggtcagcaccctcattgcacctcaggtccacaatgaggagcagggc
tgttgcatctccaactctttcttttatgcttacttataagactgctgtgtttctctctgg
gatttcccatattggtccctgtcttgtttcagaactgtagctgctgaagtcaggaagcag
atctcagggcagtatggagggtctccccagcttctcaaaaacctcaatattggaggcagc
gtctctcatcatacaaccgtaccgcttacagaagcagtggacccggttgagttggaggac
taccttattacacacccaattgcagtggagtctggacccctgagagacttgcttgagttt
ccttccgatgacattgaggttgtgtacaccccccgagaatgtcgaacgcttgtgtcggct
gtgcctgaagagagtgagatggaccctcatgtgagggactgtgtaagaagttacacagaa
gactgggcgattgtgaacagaaaataccacaaactgggaactggatttaatcccaacacc
ttagacaaacagaaggagaggcaaaaggggctccccaaacagatctttgagtctgatgaa
gctccagatggcaacagttaccaggatgaacaagatgaccttaaacgacgctcaatgtcg
attgatgatactccccggggcagctgggcatgcagtatttttgatctgaagaactccctt
ccagatgctcttctcccaaacctactggaccgaaccccaaatgaagagattgaccaccac
aatgaagatcagaggaagtccagtaggcataaggagctttttgcactacatccagcacca
gatgaggaggagcctatagaacgacttagtgtccctgaagtacccaaagaacactttggc
caaagactcctggtgaagtgtttgtcccttaaatttgaaatagaaattgagcccattttt
gcaagtttggccttgtatgatgttaaagaaaagaaaaagatttcagaaaatttctacttt
gatttaaactctgaacaaatgaaaggaatgcttcgtccacatgtcccccctgctgctata
tccacactggccagatctgccatcttttctatcacttacccctctcaagatgtctttctg
gtaataaagctggaaaaagtattacagcagggagatattggggagtgtgcagagccttat
atgatttttaaagaatctgatgcagcaaagaataaagaaaagttggaaaaactgaaatgc
caagcagagcagttttgccaaagactaggcaagtatcgcatgccttttgcctggacggcc
attcatttaatgaacattgtgagcagcgctggaagtttggaaagagattccacggaagta
gaagttggcacaggagaacgtaaaggatcgtggtcagagaggcggaattccagtattgtc
ggaaggcgttcgttagagagaaccacaagtggggatgaggcttgcaatttgaccagtttt
agaccagctactctgacagtgacaaacttctttaaacaggagggtgatcgcctgagcgat
gaagatttgtacaagttccttgctgacatgagacggccatcatcagtgttacggagattg
agacccatcacagcgcaattaaagatagacatatctccggctccagagaatccccattac
tgtctaactccagagttgctgcaagtcaaactttacccagacagcagagttagacctaca
agagaaatcctggagtttcctgccagggatgtctacgttccaaataccacatacaggaat
cttctttatgtttatcctcagagccttaactttgctaaccgccaaggatctgccaggaat
atcacagtaaaagtgcagttcatgtatggagaggaccctagcaatgctatgccggtcatc
tttggcaaatctagctgtcctgaattttccaaagaagcctacacagctgtagtatatcac
aacagatcacctgattttcatgaggaaatcaagattaagcttccagccactttaaccgat
caccaccacctgctttttactttctaccatgtcagttgccaacaaaaacaaaacaccccc
ctggagactccagtcggatacacttggataccaatgcttcaaaatggacggttaaagact
ggtcagttctgcctacctgtttcattggaaaaaccaccacaggcttattcagtgctttct
ccagaggttccactccctggcatgaagtgggtggataaccacaaaggggttttcaatgta
gaagttgttgctgtatcatccctccacactcaggacccttatcttgacaagttctttgca
cttgtccatgctctggatgagcacatgttccctgtgcgaataggagacatgagaattatg
gaaaacaacttggaaaatgaactgaagagcagcatttcagctctaaattcctctcaactg
gagccggtagtgcgatttcttcatctcctgcttgacaaactgattcttctggtagtaaga
cctcctgtcattgcaggccaaatagttaacctgggccaagcatcttttgaagcgatggca
tcaatcataaacagacttcacaagaacttggatggaaaccaggaccagcatggcagaaac
agccttcttgcctcctatatttattatgtttttcgcctaccaaatacctatcccaactca
ccatcaccaggtcctggtggcttagggggatcggtgcattatgccaccatggctcgatct
gctgtccgaccggcaagccttaacttgacccgctcacggagcctcagtaacagcaaccca
gatatatctgggacccccacctcaccggacgatgaagttcgctcgatcattggcagtaag
ggtttagaccgctccaattcctgggtaaacactggtggtccaaaagcagccccatgggga
tccaaccccagcccaagtgcagagtcaacacaggctacggatcgaagttgtaatcgtatg
tcttcgcacactgagacgtcaagtttcttacaaacattaacaggacgattaccaactaaa
aagcttttccatgaagaactggccttacagtgggtcgtgtgcagcgggagtgtgcgggag
gcagccctgcagcaggcctggttcttcttcgagctgatggtgaagagcatggtacatcat
ttgtattttgctgacaaactggatgcgccaagaaagaatcgttttcctgagcgtttcatg
gatgatgtaactgctttggtcagcacaattgctggtgatatagtctctcggtttcagaag
gatacagaaatggtcgaaaggctcaacaccagtcttgcgtttttcctcaatgacctgttg
tctatcatggacagaggatttgtttttgctcttattaagacctgctacaaacaggtgtct
tcaaagctgtattccttaacaaatccaagtaacctggcatctttaaggctggacttcctt
cgcatcatttgcagccatgaacactatgtcaccttgaacttgccctgcagcttgctcaca
ccacctgcatctccatcaccatctgtgtcttcagcaacttctcagagttctgggttctcc
acaaatgtccaagaccagaagattgcaaatatgtttgaattgtctgtgcctttccgccaa
cagcattacttggccgggcttgtgttaacagaactggctgtcattttagatcctgatgca
gaaggtttatttggattgcataagaaggtcatcaatatggtacacaatttactgtccagt
catgactcagatccacggtatgctgacccacaggtaaaggcccgggtggccatgctatat
ctacctctgattggcgtgatcatggaaaccgtgcctcagctttatgactttacagagagt
cacaatcagcgagggaggccaagctgtgtcgctgttgatgattacgaaagcgagggtgga
agcatgataagccagacagttgccatggccatcgcaggaacatctgtcccgcagctcacc
cggcccagcagttttctactcacctcatcgagtggcaggcagcactccaccttctcaacg
gagtccagccgcagccttctgatctgtctcttgtgggtgctcaagaatgcagatgaaagt
gtcttgcagaaatggttcacagacctgtcagtgttgcagctcaatcgcctgctggatttg
ctttatctttgtgtatcctgctttgaatacaagggcaagaaagtatttgaaagaatgaac
agtctgacattcaagaagtcaaaagacatgagagccaaacttgaagaagctattttggga
agcataggggcaaggcaggaaatggttcgaagaagcagaggacagctagagagaagtcct
tctgggagcgcgtttggaagtcaagagaatttgagatggagaaaggatatgactcactgg
cgtcaaaacacagaaaagcttgacaaaagccacaaaccagccagatcgagagcagagata
gaacacgaggcacttatcgatggaaatcttgcaacggaagccaatctgattattttggat
acactggagatagttgtacagactgtttctgtgacggagtccaaagagagtatcctcggt
ggggtgctgaaagtgcttctgcacagcatggcctgcaaccagagtgcactttatctccaa
cactgcttcgccacacagagggctttggtttcaaagttccctgagctgctgtttgaagaa
gagactgagcagtgtgcagatctttgcttgaggctcctgagacactgtagcagcagtatc
agcacgatacggtcgcatgcaagcgcctctctttacctactgatgaggcaaaactttgag
attgggaacaactttgccagagtgaaaatgcaagtgactatgtctctctcatccctggtg
gggacatcccagaacttcaatgaagaatatttgcgacgttccctgaagaccattttgaca
tatgctgaagaagatctggaactcagggagacaacatttcctgatcaggtccaggatcta
gtgttcaacctccatatgatcctctctgatacagttaaaatgaaggagcaccaggaagat
ccagaaatgctgattgacttgatgtacaggattgcaaagggctatcagaattcccctgac
ctgcgcctgacgtggctgcagaacatggctggaaagcactctgagaggagcaatcatgct
gagtcagcccagtgcctggtccactctgcagccttggtggctgagtatctaagcatgctg
gaagaccgaaaataccttcctgtaggatgtgttacatttcagaacatatcttccaatgtt
ttggaagagtcagcagtttctgatgatgttgtatcgccagatgaagaagggatctgttct
ggaaagtattttacagaagctggtctggtgggattgctggaacaggctgcagcatctttc
tctatggccggcatgtatgaagcagttaatgaggtttacaaagtccttattcctattcat
gaagctaatagagatgccaagaagctatctactattcatggtaaactccaggaagcgttc
agcaagattgttcaccagagtactggctgggaggatggaaagaggatgtttggcacctac
ttccgggttggtttttatggaactaagtttggagacctggatgagcaagagtttgtttac
aaggaacccgcgataacaaagttagctgaaatatcccataggctcgagggattttatgga
gagcgatttggggaagatgtgcttgaagtgattaaggactcaaaccctgtggacaaatgt
aaactagatcctaacaaggcctacattcagataacctacgtggagccgtactttgacaca
tatgagatgaaggacaggataacttacttcgataaaaactacaacttgcggcgtttcatg
tactgcacacccttcacgctggacggccgggctcacggggagctgcacgagcagttcaag
cgtaaaacgatcctgacgacgtcccacgctttcccttacattaaaaccaggataaacgtc
attcacaaagaggagatcattttgacacccattgaagttgccatagaggacatgcagaag
aaaacacaggaattggcctttgcaacccaccaagaccctgcggacccaaagatgctgcag
atggtgctgcaaggatcagtaggtaccacagtgaatcagggaccattagaagttgcacaa
gttttcttgtctgaaatacccaacgatccaaagctcttcagacatcataacaaactacgg
ctctgtttcaaagacttcacaaaaagatgtgaagatgctctgcgcaagaacaagagcctg
attggtccagaccaaaaggagtatcagcgagaacttgaaaggaattatcaccggttaaag
gaagctctccaacctttgataaatagaaagatcccacagttgtataaggcagtgctgccg
gtcacgtgccacaggtggatatttgattttactctttcagcagagataaggagggtgtaa

DBGET integrated database retrieval system