KEGG   Falco peregrinus (peregrine falcon): 101923695Help
Entry
101923695         CDS       T02856                                 

Gene name
CREM
Definition
(RefSeq) cAMP responsive element modulator
  KO
K09052  cAMP response element modulator
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101923695 (CREM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fpg03000]
    101923695 (CREM)
Transcription factors [BR:fpg03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101923695 (CREM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf Rh5 TMCO5 Phage_Gp23 DUF4988
Motif
Other DBs
NCBI-GeneID: 101923695
NCBI-ProteinID: XP_005233979
Position
Un
AA seq 113 aa AA seqDB search
MHKLIMAVTGDETAATGDMPAYQIRTPTTTLPQGVVMAASPGTLHSPQQLAEEATRKREL
RLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKALKDLYCHKAE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgcacaagctgatcatggctgtaacaggagatgaaacagctgccactggagacatgccg
gcttaccagattcggactcccactactaccttacctcagggagtggtaatggcagcctcg
ccagggactttgcatagccctcagcaactggcagaagaggcaacacgcaagagagagctg
agacttatgaaaaatagggaagctgccagagaatgtcgcagaaagaagaaagaatatgtc
aaatgtcttgaaaatcgtgtggctgtgcttgaaaaccaaaacaagactctcattgaggaa
ctcaaggccctcaaagatctttattgtcataaagcagagtaa

DBGET integrated database retrieval system