KEGG   Falco peregrinus (peregrine falcon): 101924233
Entry
101924233         CDS       T02856                                 

Gene name
MECOM
Definition
(RefSeq) MDS1 and EVI1 complex locus
  KO
K04462  ecotropic virus integration site 1 protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101924233 (MECOM)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fpg03000]
    101924233 (MECOM)
Transcription factors [BR:fpg03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Krueppel-like
    101924233 (MECOM)
SSDB
Motif
Pfam: zf-C2H2 zf-C2H2_4 zf-H2C2_2 zf-C2H2_6 zf-C2H2_jaz zf-H2C2_5 zf-BED zf-C2H2_8 zf-C2H2_11 zinc_ribbon_15 PyrI_C
Other DBs
NCBI-GeneID: 101924233
NCBI-ProteinID: XP_005241444
Position
Un
AA seq 1046 aa
MKSEDYSHETMAPDIHEERQYRCEDCDQLFESKAELVDHQKFPCSTPHSAFSMVEEDFQK
KLENENDLQDVHEIQECKECDQVFPDLQSLEKHMLSHSEEREYKCDQCPKAFNWKSNLIR
HQMSHDSGKHYECENCAKQVFTDPSNLQRHIRSQHVGARAHACPECGKTFATSSGLKQHK
HIHSSVKPFICEVCHKSYTQFSNLCRHKRMHADCRTQIKCKDCGQMFSTTSSLNKHRRFC
EGKNHFAAGGFFGQGISLPGTPAMDKTSMVNMNHANPGLADYFGANRHPAGLTFPTAPGF
SFSFPGLFPSGLYHRPPLLPTSSPVKGLPSADQTNKSQSPLMTNPQILPATQDILKALNK
QPSVGENKPVELQPERSSEERPHEKLSDQSESSDLDLDDVSTPSGSDLETTSGSDLESDI
ESEKEKFKENGKMFKDKVSSLQSLASINNKKDHSNHSIFSPSLEEQTAVSGAVNDSIKAI
ASIAEKYFGSTGLVGLQDKKVGALPYPSMFPLPFFPAFSQSMYPFPDRDLRPLPLKVEPQ
SPSEIKKIPKGSSESPFDLTIKRKEEKPLTPIPSKPAAPSAASQDQPLDLSMGSRSRASG
TKQAEPRKNHVFGEKKGGDLEQRKASESSLQHARPTPFFMDPIYRVEKRKLTDPLEALKE
KYLRPSPGFLFHPQMSAIENMAEKLESFSALKPEANELIQSVPSMFNFRAPPSALPETLL
RKGKERYTCRYCGKIFPRSANLTRHLRTHTGEQPYRCKYCDRSFSISSNLQRHVRNIHNK
EKPFKCHLCDRCFGQQTNLDRHLKKHENGNMSGTATSSPHSELESTGAILDDKEDSYFTE
IRNFIGNSNHNNQSPRNSEERMNGSHFKDEKAMVASQNSDLLDDEEAEDEVMMDEEDEES
EIAGKTVKEPVTSDMHEGTPEEDYEETSTLDMNCKASPGRYKEEEYNKTGLSALDHIRHF
TDSLKMRKMEENQYSEAELAAFNTSQLPEDLKQPLYRKSKSQAYAMMLSLSDKDSLHSAS
HNSPNMWHSMARAAAESSAIQSISHV
NT seq 3141 nt   +upstreamnt  +downstreamnt
atgaagagtgaagattattcacatgaaacaatggctccagacattcacgaggagcgccag
tatcgctgcgaggactgcgaccagctctttgagtccaaggctgagcttgtagaccaccag
aagttcccctgcagcacccctcactccgccttctccatggtggaggaggacttccagaaa
aagcttgagaatgagaatgaccttcaggatgtacatgaaatccaggagtgtaaggagtgt
gatcaagtcttcccagacttacaaagcctggagaagcacatgctgtcacacagcgaggag
agggagtacaagtgtgaccagtgccccaaagcttttaactggaagtccaacttgatacgc
caccaaatgtcgcacgacagcgggaagcactacgagtgtgaaaactgtgccaagcaggtt
ttcacggaccccagcaaccttcagaggcatattcgttcccagcatgttggggctcgtgct
cacgcttgtccagagtgtggcaaaacctttgccacttcttcaggcctcaaacagcataaa
cacatccacagcagtgtcaaaccttttatatgtgaggtctgccataaatcctatactcag
ttttcaaacctttgtcgtcataagcgcatgcatgctgattgcagaacccaaatcaagtgc
aaagactgtggacaaatgttcagcactacgtcttccttaaataaacacaggagattttgt
gagggcaagaaccattttgcagcaggaggattttttggccaaggcatttcacttcctgga
accccagctatggataaaacgtccatggttaatatgaatcatgcaaatccgggccttgct
gactattttggagccaataggcatcctgctggtcttacctttccaacagctcctggattt
tcttttagcttccctggtctgtttccttcaggcttgtaccacaggccacctttgctacct
actagttctcctgttaaaggactaccgagcgcagatcagacaaacaaaagtcaaagtccc
ctcatgacaaatcctcagatactgccagccacccaggatattttgaaggcactaaataag
caaccatcagtaggggagaataagccagtggagcttcaaccagagaggtcctctgaagag
aggccgcatgagaaactcagtgaccagtcagagagtagtgaccttgaccttgacgatgtc
agtacccccagtggcagtgacctggaaaccacctcgggctctgatctggaaagtgacatt
gaaagtgagaaagagaaatttaaagaaaatggtaaaatgttcaaagacaaagtaagctct
ctgcagagcctggcttcaataaataataagaaagaccacagcaatcattccattttctca
ccatccttagaggagcagactgcggtgtcaggagcggtgaatgattctataaaggctatt
gcttctattgctgaaaagtactttggttcaacaggacttgtggggctgcaagacaaaaaa
gtcggagccttaccttacccttccatgtttcccctcccattttttccagcattctctcaa
tcaatgtatccatttcctgatagagacttgagaccgttacccttgaaagtggagccccaa
tcacccagtgaaataaagaagattccaaagggaagctctgagtctccctttgacctcacc
ataaagcgtaaggaggagaagccacttactcccataccctcaaagccagcagccccctct
gcggcaagccaggaccagcctctagatctcagcatgggcagcagaagtcgagccagtggc
acaaaacaagccgagcctcggaaaaaccacgtctttggagaaaagaaaggaggtgacctc
gagcaaaggaaagcttcggagtcctccttgcagcacgccaggcccaccccattctttatg
gatcccatttacagagtagaaaaaagaaagttaactgacccactggaagctttaaaagag
aaatacttgagaccttccccaggattcttgtttcatccacaaatgtcagctatagaaaac
atggccgaaaagctggagagcttcagtgccctgaaaccggaggccaacgagctgatccag
tcggtgccgtccatgttcaacttccgcgcgccgccgagtgccctgcccgagaccctgctg
cgcaagggcaaggagcgctacacctgcagatactgtggcaagattttcccgagatctgca
aacctaacacgtcacctgaggacgcacactggagagcagccctatagatgcaaatactgt
gacagatcctttagcatatcttctaacctgcagagacatgtccgtaacatccacaacaaa
gagaagccattcaagtgtcacttgtgtgacaggtgttttggtcaacaaaccaatcttgac
agacatctaaaaaagcacgagaacgggaacatgtctggtactgcaacgtcttcacctcac
tcagaactggaaagcacaggggcaatcctagacgacaaggaagactcttacttcacagaa
attaggaattttattggaaacagcaaccacaacaatcagtccccccgaaactcagaggag
agaatgaatggcagccactttaaggatgaaaaagccatggtagccagccagaactcagat
ttgctggatgacgaagaggcagaagatgaagtcatgatggacgaagaagatgaagagagt
gaaattgcagggaaaacagtcaaagagcctgttacaagtgacatgcatgaggggactcca
gaggaggattacgaggaaacgagtactttggacatgaactgcaaagcttcccctggcagg
tataaagaggaggagtataataagactggactttcggctttggaccacataaggcacttc
acagatagcctcaaaatgaggaaaatggaagaaaatcaatatagtgaagctgaattggca
gctttcaatacttcccagctgccagaggacctaaaacagccgttgtacaggaaatccaaa
tcccaggcgtatgcgatgatgctttctctctcagacaaggactcccttcattctgcatcc
cacaattctcccaatatgtggcacagtatggcgagagctgctgcagaatccagtgccatt
caatccatcagtcacgtatga

DBGET integrated database retrieval system