KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0381Help
Entry
Fphi_0381         CDS       T00652                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00010  Glycolysis / Gluconeogenesis
fph00052  Galactose metabolism
fph00500  Starch and sucrose metabolism
fph00520  Amino sugar and nucleotide sugar metabolism
fph00521  Streptomycin biosynthesis
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01120  Microbial metabolism in diverse environments
fph01130  Biosynthesis of antibiotics
fph01200  Carbon metabolism
Module
fph_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Fphi_0381
   00052 Galactose metabolism
    Fphi_0381
   00500 Starch and sucrose metabolism
    Fphi_0381
   00520 Amino sugar and nucleotide sugar metabolism
    Fphi_0381
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Fphi_0381
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Fphi_0381
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Fphi_0381
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase DUF3310
Motif
Other DBs
NCBI-ProteinID: ABZ86599
UniProt: B0TZP0
Position
complement(430993..432015)
Genome map
AA seq 340 aa AA seqDB search
MYILSGDIGGTNTRLEVSLLEDGLTQSIAIRKYKGANFNCLSDIIDKFLLEVDLVGQIDS
VCLAVAGFVANGEVQVTNLPWLVSEQYISEGLGIDKSKVKVINDFEAIGYGIESLDREKD
LITLQDGKKDDETLCAVVGAGTGLGMCLVSYDKDHNPRVYKTEGGHVDFSPVDDEQIQLF
RFMRRTFHRISPERFCSGYGIFNIYKYVVRNPLYDQPECQSLRRELFSVSDSDKAAVIVK
YAIEHREPSALRTIDIFLSIYGSVAGNLALSSLPFRGLYIAGGIAPRLIKQIKESKFLEK
FRDKGRMSSMMKDFPVHIIMNTDVGLIGARTYAAGLVKVE
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgtatatattatctggagatatcggtggaactaatactaggttagaggtttctcttcta
gaagatggtttaacacagagtattgctattagaaaatataaaggagcaaactttaattgt
ttgtctgatattattgataagtttttactagaagttgatctagtggggcagattgattct
gtgtgtcttgctgttgctggatttgtcgcaaatggagaagttcaagtaacaaatttacca
tggttagtctcagagcagtatatctcagaaggtcttgggatagataaaagtaaagtcaaa
gttataaatgactttgaagccataggttatggtatagaatctttagatagagaaaaagat
ctcattactcttcaagacggtaaaaaagatgatgaaacattatgtgctgtagtcggtgct
ggtacaggtctaggtatgtgtctagttagttatgataaagatcataatcctagagtgtac
aaaacagaaggcggtcatgttgacttttcaccagttgatgatgagcaaattcaactcttt
agatttatgcgtagaacttttcatcgaatctcaccagagagattttgcagtggctatggt
attttcaatatatataagtatgttgtacgtaatcctttatatgatcagccagagtgtcaa
tcgctacgaagagaattatttagcgtatcagattctgataaagcagcagttattgttaag
tatgctatagagcatagagaaccctctgcgttgagaactatagatatatttttaagtata
tatggatcagtagcaggtaatttagcattatcaagtttaccttttagagggttgtacatc
gctggaggtattgcacctagacttattaaacaaatcaaagaaagtaagtttttagagaag
tttagagataaaggtagaatgtctagtatgatgaaagattttcctgttcatataattatg
aatacggatgtcggtctaattggtgcgcgtacctatgcggcaggattagttaaagtagag
tga

DBGET integrated database retrieval system