KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_0609Help
Entry
Fphi_0609         CDS       T00652                                 

Definition
(GenBank) Glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00330  Arginine and proline metabolism
fph00332  Carbapenem biosynthesis
fph01100  Metabolic pathways
fph01130  Biosynthesis of antibiotics
fph01230  Biosynthesis of amino acids
Module
fph_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:fph00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Fphi_0609
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Fphi_0609
Enzymes [BR:fph01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Fphi_0609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABZ86828
UniProt: B0U112
Position
complement(644038..645168)
Genome map
AA seq 376 aa AA seqDB search
MQRKKLLNAVKRIVVKVGTSTLTHQTGLLNIYRIEKLVRQLSDLHNQGYEVILVTSGAVG
AGMGKLGLQQKPKTLPEKQAVAAVGQVALTHLYQKLFSEYGKNIAQLLLTKDDVANRERY
LNARNAFSALLAKGVIPIVNENDAVVIDEIKVGDNDTLSALVANLIDADLLIILSDIDGL
YTANPRIDSSAKLLNIIPEISDDIRAMAGDVGSKFGTGGMATKIKAAEIAVAGGVNMVIA
SGEDPKILLEIILGHDIGTLFAKNNKKEITAKKHWITYSSHKRGQIIIDKGAVTALKQNK
SLLPCGIISINGDFQKGATVVVCSEDTQEIATGLVNYSSQDLAKIKGHKSYDIANILGHC
DYNEVVHVDNMFLKEC
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagaaaaaagctactaaatgcggttaagagaatagttgtaaaagttgggactagt
actctaactcatcaaaccggtttactaaatatttaccgaatagaaaagctagttagacag
ttatcagaccttcataatcaaggctatgaagtaatacttgtaacatcaggagctgttggt
gcaggtatgggtaagttagggctgcaacaaaagccaaaaactctaccagagaagcaagct
gtagctgcagtagggcaagtggctttgactcatttatatcaaaagcttttctctgaatat
ggtaagaatattgctcagttgcttctgacaaaagatgatgttgctaatagagaaagatac
ctaaatgcgcgaaatgctttttcagctttattagcaaagggggttatcccaatcgttaat
gaaaatgatgctgtagtgattgatgaaataaaagtcggtgataatgatacattatcagca
ttagttgcaaatttaatagatgctgacttgttgattattctctcggatattgatggtctg
tatacagcaaatccacgtatagatagttcagcaaaacttttaaatattatcccagaaatt
tcagatgatattcgagctatggctggtgacgtgggttctaaatttggtacaggaggtatg
gctactaagattaaggcggctgagattgctgtggctggtggtgttaatatggttattgcc
agtggagaagatcctaaaattcttttggagataatattaggtcatgatatcgggacatta
tttgcaaaaaataacaaaaaagaaatcacagctaaaaagcattggataacttatagtagc
cacaagcgaggacaaattataattgataaaggagctgttacggcactaaaacaaaacaag
agccttttaccatgtggaattatttcaattaatggagattttcaaaagggcgctacggtt
gttgtttgtagtgaagatactcaagaaatagccactggattggttaattattcatcacaa
gatttagcaaaaatcaaaggacataaaagttatgatattgctaatattttagggcattgt
gattataatgaagttgtccatgttgataatatgtttttaaaggagtgttag

DBGET integrated database retrieval system