KEGG   Francisella philomiragia subsp. philomiragia ATCC 25017: Fphi_1231Help
Entry
Fphi_1231         CDS       T00652                                 

Definition
(GenBank) hypothetical protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
fph  Francisella philomiragia subsp. philomiragia ATCC 25017
Pathway
fph00220  Arginine biosynthesis
fph00330  Arginine and proline metabolism
fph01100  Metabolic pathways
fph01110  Biosynthesis of secondary metabolites
fph01130  Biosynthesis of antibiotics
fph01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fph00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    Fphi_1231
   00330 Arginine and proline metabolism
    Fphi_1231
Enzymes [BR:fph01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Fphi_1231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase baeRF_family7
Motif
Other DBs
NCBI-ProteinID: ABZ87456
UniProt: B0TXJ8
Position
1339180..1340049
Genome map
AA seq 289 aa AA seqDB search
MKKVEAVGIAIGNAGREIGCGRAPYALLNELRDRRLDAQIINYIGGRAEVPTMGKYFTKV
AQTVSEILKEGKFPLALGGDHSCAIGTWSGVYDYLKSQKKELGLIWIDAHMDSHRPDTSE
TGNIHGMPVAHLLGYGHEELIKVLNDNPKLKPENIVFFGIRSYEKPEREFLEKLGVKVYY
QTDLTDRNFEELFLQEFERLEKVTEGNVGISFDLDGLDPTNLDAVGTPVENGIDPQVFYK
TIEKINFNSLVCFEVAEYNPLIDKTEISLKYMSKLIRLVEGNIKNLTQK
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagaagcagtaggaatagctattggtaatgctggcagagaaattggttgc
ggaagagcaccatacgctttgttgaatgagttaagagatagacgtttagatgctcaaata
atcaattacattggcggaagagctgaagtacctactatgggtaaatattttactaaggtg
gctcagacggtatctgagattcttaaagaaggtaagtttcctttagctcttggaggagat
cactcatgtgcaataggtacatggagtggagtttatgattatcttaaaagtcagaaaaaa
gagcttggtttgatttggattgatgcgcatatggatagtcatagaccagacacttctgag
actggtaatatacatggtatgcctgtagcacatcttttaggatatggccatgaggaatta
ataaaggtactaaatgataatcctaagttaaagcctgaaaatattgtcttttttgggatt
cgctcttatgaaaagccagaaagagagtttttggaaaaattgggtgttaaagtttattat
caaactgatttaactgataggaactttgaagagttatttttacaagagtttgaacgtctt
gagaaggttacagagggtaatgtggggattagttttgacttagatggtttagatcctact
aaccttgatgctgtaggaactcctgttgaaaatggtattgacccacaagttttttacaaa
actattgagaaaattaattttaatagtttggtatgttttgaagtggcagaatacaatcct
ctgattgataaaacagaaatctcgcttaaatatatgtcaaaactaataagattagttgaa
ggtaatataaaaaatctaactcaaaaatag

DBGET integrated database retrieval system