KEGG   Francisella philomiragia O#319-029: BF30_1911Help
Entry
BF30_1911         CDS       T03617                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
fpi  Francisella philomiragia O#319-029
Pathway
fpi00010  Glycolysis / Gluconeogenesis
fpi00071  Fatty acid degradation
fpi00280  Valine, leucine and isoleucine degradation
fpi00310  Lysine degradation
fpi00330  Arginine and proline metabolism
fpi00340  Histidine metabolism
fpi00380  Tryptophan metabolism
fpi00410  beta-Alanine metabolism
fpi00561  Glycerolipid metabolism
fpi00620  Pyruvate metabolism
fpi00625  Chloroalkane and chloroalkene degradation
fpi01100  Metabolic pathways
fpi01110  Biosynthesis of secondary metabolites
fpi01120  Microbial metabolism in diverse environments
fpi01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:fpi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BF30_1911
   00053 Ascorbate and aldarate metabolism
    BF30_1911
   00620 Pyruvate metabolism
    BF30_1911
  09103 Lipid metabolism
   00071 Fatty acid degradation
    BF30_1911
   00561 Glycerolipid metabolism
    BF30_1911
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BF30_1911
   00310 Lysine degradation
    BF30_1911
   00330 Arginine and proline metabolism
    BF30_1911
   00340 Histidine metabolism
    BF30_1911
   00380 Tryptophan metabolism
    BF30_1911
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BF30_1911
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    BF30_1911
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BF30_1911
Enzymes [BR:fpi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     BF30_1911
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJI48061
UniProt: A0A0E2ZFQ3
Position
1931701..1933197
Genome map
AA seq 498 aa AA seqDB search
MSILQELNLGLEAHITDDDKNVIETLSPATGELLAKVKNQNLDDMQYAITKAAEVAKQWR
QIPAPKRGELVRLIGEELRKNKDHLGSLVSLEMGKSKQEGDGEVQEMIDMADFAVGQSRM
LYGVMMNSERHDHRMYEQWHPLGVVGVISAFNFPVAVWSWNAFIAVICGNTVVWKPSEKT
PLCSIAVHNICQKVIQEHGYPEIFYTIISKDIEVSKALVNDERVNLVSFTGSTKVGQDVG
QQVAKRFGKSILELGGNNATIIDESANLKLAIPAAVFGAVGTAGQRCTSLRRLFVHESIY
DLVKDKMVNAYKQVTVGDPLDQKNLMGPLIDQASVDNFLKTVDQATIEGGKILTGGKKIA
KAGFFVEPTIIEANANMPIVAEENFCPILYIMSFKDIDEAIKLNNSVRYGLSSSIFTDNI
QNAEKFLSSLGSDCGIANVNIGTSGAEIGGAFGGEKHTGGGREAGSDAWKAYMRRQTSTI
NYGKDLPLAQGIKFNLED
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgagtattttacaagaattaaatttaggtttagaagcacatataactgatgatgataaa
aatgttatagaaactttaagtccagcaactggtgagcttttagctaaagttaaaaatcaa
aacctagatgatatgcaatatgctattacaaaggctgctgaggttgctaaacaatggcgt
caaattccagcacctaaaagaggagagttagttagacttattggcgaagagctccgtaaa
aataaagatcatctaggaagcttagtatctcttgagatgggtaaatctaagcaagaaggt
gatggcgaagttcaagagatgattgatatggcagattttgctgtaggacaatcacgtatg
ttatacggtgtgatgatgaattctgagcgtcacgatcatagaatgtatgagcaatggcat
ccattaggagtagttggagttatttctgcatttaactttccagtagctgtgtggtcttgg
aatgcttttatagctgtcatttgtggtaatactgtagtgtggaaaccttcagaaaagaca
ccattatgctcaattgctgtacacaatatatgtcaaaaagtaattcaagagcatggttat
cctgaaattttttatacaataatttctaaagatattgaggtttcaaaggcattagttaat
gatgaaagagtaaacttagtatctttcacgggttcaacaaaagttggtcaagatgtagga
caacaagtcgctaaaagatttggtaagtcaattttagagctaggtggtaataatgctaca
attattgatgaatcagctaacctaaaattagcaataccagcagctgtttttggagcagtt
ggtacagcagggcagagatgtacttctctaagaagactatttgtgcatgaatcaatctat
gatttggtcaaagataaaatggtcaatgcctacaaacaagttacagttggagatccgcta
gatcaaaaaaatcttatgggacctcttatagatcaagcatcagttgataattttttaaaa
actgtagatcaagctacaatagaaggcggtaaaattttaactggtggtaaaaaaatcgca
aaagctggtttctttgttgagccaacaataattgaagcaaatgctaatatgccaatagta
gcagaagagaatttctgtcctattttgtacataatgtctttcaaagatattgatgaagca
atcaaactcaacaatagtgtcagatatggtttatcaagctctatatttactgataatatc
caaaatgctgagaagtttctatcgagtttaggtagtgattgtggtattgctaatgtaaac
attggtacatcaggtgctgaaattggaggcgcgtttggtggtgaaaagcatactggaggc
ggtcgtgaagctggttcggatgcgtggaaggcatatatgcgacgtcaaactagcacgatt
aattatggtaaagatttaccattagcacaaggaatcaaatttaatctggaggattag

DBGET integrated database retrieval system