KEGG   Francisella philomiragia GA01-2801: LA02_195Help
Entry
LA02_195          CDS       T03621                                 

Gene name
rplV
Definition
(GenBank) ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
fpj  Francisella philomiragia GA01-2801
Pathway
fpj03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fpj00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    LA02_195 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fpj03011]
    LA02_195 (rplV)
Ribosome [BR:fpj03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    LA02_195 (rplV)
  Bacteria
    LA02_195 (rplV)
  Archaea
    LA02_195 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AJI56858
UniProt: A0A0E2ZCC1
Position
complement(161900..162235)
Genome map
AA seq 111 aa AA seqDB search
MEVQAKLKFAKISAQKCRLVADQIRGLPVEKAINLLTFSNKKAAVLIKDVLNSAIANAEH
NDGMDVDSLFVSTVFVDEGPTMKRFEARAKGRGNRILKRTSHITVKVAEKN
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atggaagtacaagctaaattaaaatttgcaaaaatctcagctcaaaaatgtagattggtt
gctgatcagatcagaggtctacctgtagagaaagctattaatcttttgacttttagcaat
aagaaagcagcagtgttgattaaagatgttttaaattcagcaattgctaacgcagaacac
aatgacggtatggatgttgattctttatttgtttcaactgtatttgttgatgagggtcct
actatgaagcgttttgaagctagggcaaaaggtcgtggtaatcgtattttaaagagaact
tcacatattactgtgaaagttgctgagaaaaattaa

DBGET integrated database retrieval system