KEGG   Flavobacterium psychrophilum v4-33: IA06_06585Help
Entry
IA06_06585        CDS       T03661                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
fpk  Flavobacterium psychrophilum v4-33
Pathway
fpk00051  Fructose and mannose metabolism
fpk00520  Amino sugar and nucleotide sugar metabolism
fpk01100  Metabolic pathways
fpk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:fpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    IA06_06585
   00520 Amino sugar and nucleotide sugar metabolism
    IA06_06585
Enzymes [BR:fpk01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     IA06_06585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer AP_endonuc_2
Motif
Other DBs
NCBI-ProteinID: AIG41493
UniProt: A0A076P251
Position
complement(1428298..1429359)
Genome map
AA seq 353 aa AA seqDB search
MNKDYYAILMAGGVGSRFWPVSTTEFPKQFHDMLGSGETLIQKTFSRLAKLIPAENILIL
TNESYNHLVLEQLPMVKQEQVLLEPAMRNTAPCILYASLKIQKANPNAVMVVAPSDHWIE
DETSFARNLQECFDFCAKENALMTLGIQPTFPNTGFGYIEYDKTDANPIKKVNQFREKPD
YETAKLFLDSGNFLWNGGIFIWSVKTITEAFSVFQPKMNDLFLQGLESYNTPAEKQFIEE
NYALAENISIDYAVMEIAKNVYVLPATFDWNDLGTWGSLHEKLDKDENNNAVVNAKVLLE
NSSNNIVRSDADKLIVIDGLHDYIIVDKEGILLIYPKSKEQDIKSIVKKLEQN
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagattattacgcaatattaatggctggtggtgttggatcacgattttggcca
gtaagtacaaccgaatttcctaaacaatttcatgacatgttaggttcgggagaaacacta
atacaaaaaactttctctagattagccaaattaattcctgccgaaaatattctgatttta
actaacgaaagttataatcatttggttttagaacaattgccaatggtaaaacaagaacaa
gttttgttagaaccagccatgcgaaatacagcaccttgcatcttgtatgcctcactaaaa
attcaaaaagcaaacccaaatgcggtaatggttgtggcaccaagcgatcactggatagaa
gacgaaacatcttttgctagaaatttgcaagaatgtttcgatttttgtgccaaagaaaac
gcactgatgactttaggaatacagcctacatttcccaatacaggttttgggtatatcgaa
tacgataaaaccgatgccaatccgataaaaaaagtaaaccaatttagagaaaaaccagat
tacgaaaccgcaaaactattcctcgattcaggaaatttcctttggaatgggggtattttt
atttggagtgtaaaaacaataacagaagcattctccgtatttcagccaaaaatgaatgac
ttgttcctgcaaggattagaaagttataatacgcctgccgaaaaacaatttatagaagaa
aattatgcgcttgccgaaaacatttctatcgattatgccgtgatggaaatcgctaaaaac
gtttacgtattgcccgccactttcgactggaatgacctagggacttggggttccttacac
gaaaaactagacaaagacgaaaacaataatgccgttgtaaatgccaaagttttactcgaa
aactcctctaacaacattgttcgttccgatgccgacaagctcattgttatagatggttta
cacgattatatcattgtagataaagaaggtattttgctaatttacccaaaaagtaaagaa
caggatataaaaagtattgtaaagaaattggaacagaattaa

DBGET integrated database retrieval system