KEGG   Flavobacterium psychrophilum v4-33: IA06_09905Help
Entry
IA06_09905        CDS       T03661                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K20866  glucose-1-phosphatase [EC:3.1.3.10]
Organism
fpk  Flavobacterium psychrophilum v4-33
Pathway
fpk00010  Glycolysis / Gluconeogenesis
fpk01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    IA06_09905
Enzymes [BR:fpk01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.10  glucose-1-phosphatase
     IA06_09905
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase GvpG SHOCT Hydrolase_like
Motif
Other DBs
NCBI-ProteinID: AIG42098
UniProt: A0A076NY65
Position
2139482..2140093
Genome map
AA seq 203 aa AA seqDB search
MINTIIFDFGDVFINIDSKASLNALKKLGLNSWNDELEKLNQEFERGKITEAQFMIELKK
IIPNASIDDLKTAWNLVLLDFPLQRLEFLQQLSMLNYKLFLLSNTNETHIEKFEHMLGAT
FTRDFYQCFEKVYFSFEIGVCKPDPQAFDYIIRKHNLLAKNTLFIDDKKENTDIAAALGM
QIWNIIPEKEDITQLFDKKFILK
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atgattaacactattatcttcgattttggcgatgtatttatcaatattgatagtaaagct
tcgcttaatgcgctaaaaaaattaggtctaaactcctggaatgatgaactcgaaaagttg
aaccaagaatttgaacgaggaaaaataaccgaagctcagtttatgattgaacttaaaaaa
ataatcccaaacgcttctatagatgacctaaaaacagcttggaacttggtgcttttagat
tttccgttacaaagattagaatttttgcaacaattgtctatgctaaattataaattattt
ttactaagcaatactaatgaaactcatattgagaaattcgagcacatgcttggtgcaaca
tttactagagatttttaccaatgtttcgaaaaagtatatttttctttcgaaattggcgta
tgcaaaccagatccgcaagctttcgattacattatcagaaaacataacttgctagcaaaa
aacactctatttatagatgataaaaaagaaaacacagatatagcagccgctttaggtatg
caaatttggaatatcattcctgaaaaagaagatattacccagctttttgacaaaaaattt
attcttaaataa

DBGET integrated database retrieval system