KEGG   Ferroglobus placidus: Ferp_0682Help
Entry
Ferp_0682         CDS       T01172                                 

Definition
(GenBank) peptidase M20
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00300  Lysine biosynthesis
fpl01100  Metabolic pathways
fpl01120  Microbial metabolism in diverse environments
fpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Ferp_0682
Enzymes [BR:fpl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Ferp_0682
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ADC64853
UniProt: D3RWJ0
Position
598398..599537
Genome map
AA seq 379 aa AA seqDB search
MRSQSSSIALRVLEELIKIDTRNPPGRTSEAVDFLENVFSSYETRVYEAEEGKENLVVEI
SKGKKTLMFNSHLDTVPAKGILLNPVFVDGKVYGRGSCDAKGCVAAIVEAFLNFEPEVGV
KLSFTADEEVGGKLGLDYVLEKERADYVIVSEPFGSDSIGVAQAKVYSVDVIVKGSSGHT
ASADVKRGAIYKASKLIVSAVDFFSSIDRRDLESLQKLLEVPVEIRGRGVAAFNPAIIEG
GVKRNVVAEKCVIKADVRMMPWISEEEIFSKLIDKDVELIVQGVLKPYGISFDGVDLNED
LKFFEIIKSSIASFGLKPKATVSLGVGDIRHARKRGIPAFYLGPKGENLHADDEFVYIDE
IFRVAKIYRKIAEKLAEIT
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgagatctcaaagctcgtcgatcgccttaagagttcttgaagagctgataaagatcgac
acgagaaaccctccggggagaacgagcgaagctgtcgacttccttgagaacgttttttcg
agctacgaaacgagagtttacgaagctgaagagggcaaggagaaccttgtggtcgaaata
agcaaagggaagaaaactctgatgtttaactcgcacctcgacacggttccggcgaagggg
atccttttaaatcctgttttcgttgacggaaaggtttacggaagaggtagctgcgacgct
aaagggtgcgtcgctgcaattgtggaagctttcctgaacttcgaaccggaagttggagta
aagctgagcttcacggctgacgaggaggttggtggaaagctcggcttagactacgttctt
gaaaaagaaagagctgattatgtaatagtctctgagcctttcggcagcgacagcattgga
gtagctcaggcgaaggtttattcagtggatgtgattgtgaagggaagctccggacataca
gcttcggcggacgttaaaagaggagcgatttacaaagcttcaaaactaatagtaagtgcg
gtggatttcttcagctcgattgacagaagagacctcgaaagtcttcaaaaactccttgaa
gttccggtggagataagagggagaggtgttgcagcatttaatccggcgataatagaggga
ggagttaagagaaacgtcgtcgctgagaaatgcgtaataaaagctgatgtaaggatgatg
ccttggattagcgaagaagaaattttctcgaagctaatcgataaagatgtcgagcttatt
gttcagggagttctgaaaccttacggaataagcttcgacggagtcgatttgaacgaggat
ctaaaatttttcgaaattataaaaagttcgatagcttccttcggcttaaaacccaaagcc
accgtctctctcggcgtgggagatataagacatgcgagaaaaaggggaattccagctttt
tacctcggtcctaaaggagaaaatctgcacgccgacgatgaattcgtttacatcgacgag
atttttagagttgcgaaaatctacagaaaaattgccgagaagcttgccgagatcacttga

DBGET integrated database retrieval system