KEGG   Ferroglobus placidus: Ferp_2213Help
Entry
Ferp_2213         CDS       T01172                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
fpl  Ferroglobus placidus
Pathway
fpl00260  Glycine, serine and threonine metabolism
fpl00750  Vitamin B6 metabolism
fpl01100  Metabolic pathways
fpl01110  Biosynthesis of secondary metabolites
fpl01120  Microbial metabolism in diverse environments
fpl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:fpl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Ferp_2213
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Ferp_2213
Enzymes [BR:fpl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Ferp_2213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP zf-HIT PK_C C1_2
Motif
Other DBs
NCBI-ProteinID: ADC66339
UniProt: D3S0U8
Position
complement(1914716..1915930)
Genome map
AA seq 404 aa AA seqDB search
MKVVGLKCRICGKEFPAEALYTCDNCFGPLEVVYDWEWIKENVSKEKIEKGPKTLWRYKD
FLPVEAEPVDLGAGYTRFIKAENLGEVLGLKNLYLLDDSTNPTYSFKDRVVSVAVTKAKE
FGMKALGCASTGNLAGSLAAHAAKAKLPAYIFVPAGIEKNKIIQALVHGAKVIEVEGTYD
DANRLATEVAEEHPDWGFVNINLRPYYAEGSKTLAYETAERLGWELPDQVVVPMASGALL
CAIHRGFKDLIRVGLVDEKDVVFNGCQPEGFPIVRAVKEGKPVTPIREIKTIVHSLAIGN
PADGIFAKEIIEKSGGYAEDPSDLEVIEAVKLLAKTEGIFTELAGGVTVAGLKRLVEEGR
IDKSDVVVIYLTGNGLKTSEALVDYLETTVRIKPRLEEFEEVVA
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggtggggcttaagtgcagaatttgcggcaaggagtttccggctgaagctttg
tacacttgcgataactgttttggtcctttagaagtcgtgtacgactgggagtggattaag
gaaaacgttagcaaggaaaagatagaaaaaggtccgaaaactctctggaggtacaaggac
tttctccccgttgaagctgagcctgtggatctcggggctggatacacgaggttcataaaa
gctgaaaacctcggagaagtcctcggcttgaaaaacctctacctgttagacgactcaacg
aacccaacttactcgttcaaagacagagttgtgagcgttgccgtgacgaaggctaaggag
tttggaatgaaagccctcggctgcgcctctactggcaacctggctggaagcttggctgct
cacgctgcgaaggcaaaattgccagcatacatcttcgtacctgctggaattgagaagaac
aagataatacaggctttggttcacggggctaaggttatcgaagtggaaggcacctacgac
gacgctaacagattggcaacggaagttgctgaggagcatccggactggggattcgtgaac
ataaacctccgcccctactatgccgaggggagtaagacgttggcttacgaaactgccgaa
agattggggtgggagcttccggatcaagtggttgtgccgatggcttcaggagctttgctt
tgcgcaatacacagaggtttcaaagacttgataagggtcggactcgtagatgagaaagat
gtcgtattcaacggatgtcagcctgagggatttccgatagttagggctgtgaaggaaggg
aagccggtaacgcctataagagagattaaaacaatcgtccacagcttggcaataggcaat
ccggcagatggaatcttcgctaaggagataatagaaaagagcggtggttacgctgaagat
cccagcgatttagaggtaattgaagcggttaagctacttgcgaagaccgaaggaatattc
accgaacttgccggaggagtaaccgttgctggattgaaaaggttggtcgaagaggggaga
attgataaaagtgatgtcgtcgttatatacttgacggggaatgggttgaagacatccgaa
gctttggtggattacctcgaaacgacggtgagaataaagccgagactcgaagaatttgag
gaggtggtggcttga

DBGET integrated database retrieval system