KEGG   Flavonifractor plautii: A4U99_00260
Entry
A4U99_00260       CDS       T04429                                 

Definition
(GenBank) xanthine dehydrogenase molybdenum-binding subunit XdhA
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00230  Purine metabolism
fpla01100  Metabolic pathways
fpla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4U99_00260
Enzymes [BR:fpla01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     A4U99_00260
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C DUF2866
Other DBs
NCBI-ProteinID: ANU39587
UniProt: A0A1C7FJR9
Position
49563..51863
AA seq 766 aa
MEVGRSIPRVDAADKVTGRAKYTDDLCPRPVLEAKILHSTIADGWVKSMDISAAQALPGV
VKVLTCFDVPDIQYPTPGHPWSVEKAHQDVSDRKLLNRRVRIYGDDIAAVVAEDEITARR
ALELIRVEYEEYPVVLEPEQAMAEGAPVLHEEHPDNILARMDLRTPMPESDFHSVEDVLA
CPAYYQFRGHYDTQQVQHCHIENPISYAWMEGGRIVVVTSTQIPHIVRRVIGQAMGIGWG
SIRVIKPYIGGGFGNKQEVLYEPLNAWLTTQVGGRCVRLDVSREETFQNTRSRHPISFDV
AAAVDGDMRLMARSCTAVSNQGGYASHGHSIVANAVTGFRQLYLDQIGHHSTAYTVYTNR
PAPGAMRGYGIPQCNFAVECMMDDIAREKGWDPKAFRLANLMPLGYVDPFNGITCHSTGL
AECIEKGAYFIGWAELREKYKEQTGPVRRGVGMACFSYKTGVYPISLETASARMVLNQDG
TVQLHLGATEIGQGGDTVFSQMAAQAIGIPTEDVHIVSFQDTDTAPFDTGAYASRQTYVT
GKAIKKVGEEFREKLLAYAAELFPDASGLDIRERQIVDGAGEALISLADLAMTAFYSLEH
SVHITAEDTNHCKENTFAFGCCFAEVEVDIPVGKVRVLRIVNVHDSGKLINPALAEAQVH
GGMSMGIGYALTEEMKFDPKTGRLLNGNLLDYKMPTSMDHPELTALFVETDDPSGPFGNK
ALGEPPTIPVAPAIRNAVLQATGVAVNSLPLSPQKLVEEFTRGGLI
NT seq 2301 nt   +upstreamnt  +downstreamnt
atggaagtcgggaggagcatcccccgcgtggacgccgccgacaaggtcaccggccgcgcc
aaatacaccgacgatctctgcccccgtccggtgctggaggcgaagattctccacagcacc
attgccgacggctgggtcaagtccatggacatctccgccgcccaggccctgcccggggtg
gtgaaggtgctgacctgctttgacgtgccggacatccagtaccccacccccggccacccc
tggagcgtggagaaggcccatcaggacgtgtccgaccgcaagctgctcaaccgccgtgtg
cgcatctacggcgacgacattgccgccgtggtggcggaggacgagatcaccgcccgccgg
gccctggagctgatccgggtggagtatgaggagtaccccgtggtgctggagccggagcag
gccatggcggagggcgcgccggtgctccacgaggagcacccggacaacatcctggcccgg
atggatctccgcacgcccatgccggagtcggacttccacagcgtggaggacgtgctggcc
tgccccgcctattaccagttccggggacactacgacacccagcaggtgcagcactgccac
atcgagaaccccatctcctacgcctggatggagggggggcgcatcgtggtggtcacctcc
acccagatcccccacatcgtccgccgggtgatcggccaggccatgggcatcggctggggc
tccatccgggtgatcaagccctacatcggcggcggcttcggcaacaagcaggaggtgctc
tacgagcccctcaacgcctggcttaccacccaggtggggggccgctgtgtccggctggac
gtctcccgggaggagaccttccagaacacccgctcccgccaccccatctcctttgacgtg
gcggcggcggtggacggcgacatgcgcctgatggcccgctcctgcaccgccgtctccaac
caggggggctacgcctcccacggccactccatcgtggccaatgccgtcacgggcttccgg
cagctctatctggatcagatcggccaccactccacggcctacaccgtctacaccaaccgg
cccgcccccggcgccatgcggggctacggcattccccagtgtaacttcgctgtggagtgc
atgatggacgacattgcccgggaaaagggctgggatcccaaggccttccggctggcaaac
ctcatgcccctgggctatgtagaccccttcaacggcatcacctgccactccaccggcctg
gccgagtgcatcgagaagggcgcgtacttcatcggctgggcggagctgcgggagaagtac
aaggagcagaccggcccggtgcgccggggcgtgggcatggcctgcttctcctacaagacc
ggcgtgtaccccatctccctggagacggcctccgcccgtatggtgctcaaccaggacggc
acggtgcagctccacctgggggccaccgagatcggccaggggggcgacaccgtgttctcc
cagatggccgcccaggccatcggcattcccaccgaggacgtacatattgtctccttccag
gacaccgacaccgccccctttgatactggggcctacgcctcccggcagacctacgtcacc
ggcaaggccatcaaaaaggtgggggaggagttccgggagaagctcctcgcctacgccgcc
gagctgttccccgacgcatcgggcctggacatccgggagcggcagattgtggacggggcg
ggggaggccctcatctccctggccgacctggccatgaccgccttctactccctggagcac
agcgtccatattaccgccgaggacaccaaccactgcaaggagaacaccttcgccttcggc
tgctgcttcgccgaggtggaggtggacatacccgtgggcaaggtgagggtgctgcgtatc
gtcaacgtccacgactcggggaagctcatcaaccccgccctggcggaggcccaggttcac
ggcggcatgagcatgggcatcggctacgccctcaccgaggagatgaagttcgatcccaag
accggccggctgctcaacggcaacctgctggactacaagatgcccacctctatggaccac
ccggagctcaccgccctgttcgtggagaccgacgatccctccggcccctttggaaacaag
gctctgggggagccgcccaccatccccgtggccccggccatccgcaatgcggtgctccag
gccaccggcgtggcggtgaattccctgcccctgtcgccccagaagctggtggaggaattt
acgagaggagggctgatctga

DBGET integrated database retrieval system