KEGG   Flavonifractor plautii: A4U99_00270
Entry
A4U99_00270       CDS       T04429                                 

Definition
(GenBank) xanthine dehydrogenase
  KO
K13480  xanthine dehydrogenase iron-sulfur-binding subunit
Organism
fpla  Flavonifractor plautii
Pathway
fpla00230  Purine metabolism
fpla01100  Metabolic pathways
fpla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    A4U99_00270
SSDB
Motif
Pfam: Fer2_2 Fer2 Fer2_3
Other DBs
NCBI-ProteinID: ANU39589
UniProt: A0A1C7FI27
Position
52743..53234
AA seq 163 aa
MIEVLRCTVNNKPVEVGIDPRESLADVLRERLGLTSVKKGCEVGECGACTVLVDGTAIDS
CIYLGVWAQGKSILTVEGLQDADGGLSPIQRAFVEEAAVQCGFCTPGIIMSAVEIVGSGK
QYTREELRKLISGHLCRCTGYQNILNAVERAVDEAHRFVGKGE
NT seq 492 nt   +upstreamnt  +downstreamnt
atgatcgaagtgctgcgctgtaccgtgaacaacaagcctgtggaggtgggtatcgacccc
cgggagtccctggccgacgtgctgcgggagcggctgggcctcaccagcgtgaagaagggc
tgcgaggtgggggagtgcggggcctgcaccgtcctggtggacggcacggccatcgactcc
tgcatctacctgggcgtgtgggcccagggtaagagtatcctcaccgtggagggcctccag
gacgcagatgggggcctgtcccccatccagcgggcctttgtggaggaggccgccgtccag
tgcggcttctgcacccccggcatcatcatgtccgccgtggagatcgtgggctccggcaag
cagtacacccgggaggagctgcgcaagctcatctccggccacctgtgccgctgcaccggc
tatcaaaacattctgaacgccgtggagcgggcggtggacgaggcccacaggttcgtggga
aaaggggaataa

DBGET integrated database retrieval system