KEGG   Flavonifractor plautii: A4U99_00290Help
Entry
A4U99_00290       CDS       T04429                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00071  Fatty acid degradation
fpla00072  Synthesis and degradation of ketone bodies
fpla00280  Valine, leucine and isoleucine degradation
fpla00310  Lysine degradation
fpla00362  Benzoate degradation
fpla00380  Tryptophan metabolism
fpla00620  Pyruvate metabolism
fpla00630  Glyoxylate and dicarboxylate metabolism
fpla00640  Propanoate metabolism
fpla00650  Butanoate metabolism
fpla00900  Terpenoid backbone biosynthesis
fpla01100  Metabolic pathways
fpla01110  Biosynthesis of secondary metabolites
fpla01120  Microbial metabolism in diverse environments
fpla01130  Biosynthesis of antibiotics
fpla01200  Carbon metabolism
fpla01212  Fatty acid metabolism
fpla02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A4U99_00290
   00630 Glyoxylate and dicarboxylate metabolism
    A4U99_00290
   00640 Propanoate metabolism
    A4U99_00290
   00650 Butanoate metabolism
    A4U99_00290
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A4U99_00290
   00072 Synthesis and degradation of ketone bodies
    A4U99_00290
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A4U99_00290
   00310 Lysine degradation
    A4U99_00290
   00380 Tryptophan metabolism
    A4U99_00290
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A4U99_00290
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A4U99_00290
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A4U99_00290
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpla04147]
    A4U99_00290
Enzymes [BR:fpla01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A4U99_00290
Exosome [BR:fpla04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A4U99_00290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANU39592
UniProt: A0A174H076
Position
complement(55286..56545)
Genome map
AA seq 419 aa AA seqDB search
MKEVYVVNCCRTAVGSFGGSLKDTPATELGAVVVKEALNRAGVKPEQVDELMFGCVLTAA
LGQNPARQVGVKAGLPYSVPAYTVGMVCGSGMKSVIEGARAILCGDADIIVAGGTENMSA
APYALPAERWGARMGDKKVVDTMIKDGLWDAYNNYHMGTTAENICDVWGITREELDAFGA
ASQQKTEAAQKAGRFDDEIVPVMVKKKKEMVEFKVDEFPRAGTTVESLGKLKGAFPVGPE
GVEDEIVHTFEPTQVHADDAHKHVQRVTAGQASGINDGAAAIVLASKEAVEKYGLKPMAK
LVSWGHGGVDPKIMGVGPVPASRQAMSKAGLKIEDIDLVEANEAFAAQSIAVARELGFDM
EKVNVNGGAIAIGHPVGCSGARIIVTLLHEMAKRPDAKKGLATLCIGGGMGVATIFEKC
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaagtgtatgtggtcaactgctgccggacggcagtgggctccttcgggggcagc
ctgaaggacacccccgcaacggagctgggtgccgtggtggtgaaggaggcgctgaaccgc
gccggagtgaagccggagcaggtggacgagctgatgttcggctgcgtgctcaccgccgcc
ctgggccagaaccccgcccgccaggtgggcgtgaaggcgggcctgccctactccgtgccc
gcctacaccgtgggcatggtttgcggctccggcatgaagagcgtcatcgagggcgcccgc
gccatcctgtgcggcgatgccgacatcatcgtggccggcggcaccgagaacatgtccgcc
gccccttacgccctccccgccgagcgctggggcgcccgtatgggcgacaagaaggtcgtg
gacaccatgatcaaggacggcctgtgggacgcctacaacaactaccacatgggcaccact
gcggagaacatctgcgacgtgtggggcatcacccgcgaggagctggatgccttcggcgcc
gcctcccagcagaagaccgaggcggcccagaaggccggacggtttgacgacgagatcgtg
cccgtcatggtcaagaagaagaaggaaatggtggagttcaaggtggacgagttcccccgc
gccggcaccactgtggagagcctgggcaagctgaagggcgccttccccgtgggtccggag
ggcgtggaggacgagattgtccacacctttgagcccacccaggttcacgcggatgacgcc
cacaagcatgtgcagcgggtgactgcgggccaggccagcggcatcaacgacggcgcggcc
gccattgttctggcctccaaggaggccgtggagaagtacggcctcaagcccatggccaag
ctggtgagctggggccacggcggcgtggatcccaagatcatgggtgtcggccccgtgccc
gccagccgtcaggccatgagcaaggcgggccttaagatcgaggacattgatctggtggag
gccaacgaggcctttgccgcccagtccatcgccgtggcccgcgagctgggcttcgacatg
gagaaggtcaacgtcaacggcggcgccatcgccatcggccaccctgtcggctgctccggc
gcccgcatcatcgtcaccctgctccatgagatggccaaacggcccgatgccaagaagggc
ctggccaccctgtgcatcggcggcggcatgggtgttgccaccatcttcgaaaagtgctaa

DBGET integrated database retrieval system