KEGG   Flavonifractor plautii: A4U99_01830Help
Entry
A4U99_01830       CDS       T04429                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
fpla  Flavonifractor plautii
Pathway
fpla03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    A4U99_01830
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fpla03011]
    A4U99_01830
Ribosome [BR:fpla03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    A4U99_01830
  Bacteria
    A4U99_01830
  Archaea
    A4U99_01830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: ANU39868
UniProt: A0A174UE70
Position
405156..405488
Genome map
AA seq 110 aa AA seqDB search
MEAKAHLRYARISPRKVQIVCDLIRGKSVAQANAILMGTPKAASELLLKLLKSAASNAEN
NHQMDPEKLYVSQVFACPGPIIKRMMPRAQGRAYRINKRTSHITIAVAER
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaagcgaaagcacatctgagatatgcccgtatctctccccgtaaggtccagatcgtc
tgcgacctgatccgcggcaagagcgtggcccaggccaacgccatcctcatgggcaccccc
aaggctgcctccgagctgctgctgaagctcctcaagagcgccgcgtccaacgcggagaac
aaccaccagatggaccccgagaagctgtatgtttcccaggtgttcgcctgccccggcccc
atcatcaagcggatgatgccccgggcccagggccgcgcctatcgcatcaacaagcgcact
tctcacatcaccatcgcggtggctgaacgctaa

DBGET integrated database retrieval system