KEGG   Flavonifractor plautii: A4U99_07260Help
Entry
A4U99_07260       CDS       T04429                                 

Definition
(GenBank) tRNA glutamyl-Q(34) synthetase GluQRS
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00860  Porphyrin and chlorophyll metabolism
fpla00970  Aminoacyl-tRNA biosynthesis
fpla01100  Metabolic pathways
fpla01110  Biosynthesis of secondary metabolites
fpla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    A4U99_07260
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    A4U99_07260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fpla01007]
    A4U99_07260
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpla03016]
    A4U99_07260
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:fpla02048]
    A4U99_07260
Enzymes [BR:fpla01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     A4U99_07260
Amino acid related enzymes [BR:fpla01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   A4U99_07260
Transfer RNA biogenesis [BR:fpla03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    A4U99_07260
 Prokaryotic Type
   Other AARSs
    A4U99_07260
Prokaryotic defense system [BR:fpla02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    A4U99_07260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: ANU40876
UniProt: A0A1C7FN11
Position
1518722..1519663
Genome map
AA seq 313 aa AA seqDB search
MGGIVRGRFAPSPSGRMHLGNVFSALLAWLSVRRAGGVMVLRMEDLDPDRCRAAYAEQLA
DDLRWLGLDWDEGYQKGGPHGPYLQSERTAQYAAAFRALEERGLVYPCYCTRAERLAASA
PHRSDGQAVYSGKCRHLTAEERAQLGQTRCPAWRLIVPDQEISFTDSLQGLYRENLLRDC
GDFILCRSDGVYAYQLAVVCDDGDMGITQVVRGRDLLDSTPRQLYLYGLLGLTPPEFYHV
PLLLAADGRRLSKREHDLDMGALRERFTPAELTGRLAFWAGQTDRPEPVTPAELAGCFEW
ANVPPGDITVEQF
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtggggggaatcgtacggggacgctttgcccccagccccagcggccggatgcacctgggc
aatgtgttctccgccctgctggcgtggctgtcggtgcggcgggccgggggtgtcatggtg
ctgcggatggaggatctggaccccgaccgctgccgggcggcgtacgccgagcagctggcc
gacgatctccgctggctggggctggactgggatgagggctatcagaagggcgggccccac
ggcccctacctccaaagcgagcggacggcgcagtacgccgctgccttccgggcgctggag
gagcgcgggctggtctacccctgctactgcacccgggcggagcgcctggcggccagcgcc
ccccaccgctccgacggacaggcggtctactctggcaagtgcagacacttgacagcagag
gagcgcgcccaactgggccagacccgctgtcccgcctggcgtttgatcgtgcctgaccag
gagatttcctttacagatagcctgcaggggctgtaccgggaaaacctgctccgcgactgc
ggggacttcattctctgccgctccgacggggtgtacgcctaccagctggcggtggtgtgt
gacgacggggacatggggatcacccaggtggtgcgggggcgggatctgctggactccacc
ccccggcagctctatctctatggactgctgggcctaacgccgccggagttttaccatgtg
ccccttctgctggccgccgacgggcggcggctgtccaagcgggaacacgatctggacatg
ggcgccctgcgggagcggttcaccccggcggagctgaccggccgcctggccttctgggct
ggacagaccgaccggccggagccggtgactccggcggagctggcgggctgctttgaatgg
gcaaacgtcccccccggggacatcacggtggagcagttctaa

DBGET integrated database retrieval system