KEGG   Flavonifractor plautii: A4U99_15110
Entry
A4U99_15110       CDS       T04429                                 

Definition
(GenBank) ornithine aminomutase
  KO
K17899  D-ornithine 4,5-aminomutase subunit alpha [EC:5.4.3.5]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00472  D-Arginine and D-ornithine metabolism
fpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    A4U99_15110
Enzymes [BR:fpla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     A4U99_15110
SSDB
Motif
Pfam: OAM_alpha Lys-AminoMut_A
Other DBs
NCBI-ProteinID: ANU42314
UniProt: A0A174V347
Position
3129012..3129374
AA seq 120 aa
MKRADDFAERRKHIANLTDQELYDRFWALTEQVVAPLLELGRRNTTPSVERAVLLRMGIS
SLETQKIVEGCMDHSLMSHGAGHVVYKLSREKNLSIPEAGHLLAQGKYWDEAAALFKEGK
NT seq 363 nt   +upstreamnt  +downstreamnt
atgaagcgtgccgatgattttgctgagagaagaaagcatatcgccaatctgaccgaccag
gagctgtatgaccgcttctgggcgctgaccgagcaggtggttgccccgctgctggagctg
ggccgcaggaataccaccccctcggtagagcgtgccgtgttgctgcggatgggcatctcc
tctctggaaacccagaagattgtggagggctgtatggatcacagcctgatgagccacggc
gccggccatgtagtctacaagctgtccagggagaagaatctctccattccggaggccgga
cacctgctggcccaggggaagtactgggatgaagccgccgcgctgttcaaggaggggaag
taa

DBGET integrated database retrieval system