KEGG   Flavonifractor plautii: A4U99_15115
Entry
A4U99_15115       CDS       T04429                                 

Definition
(GenBank) LuxR family transcriptional regulator
  KO
K17898  D-ornithine 4,5-aminomutase subunit beta [EC:5.4.3.5]
Organism
fpla  Flavonifractor plautii
Pathway
fpla00472  D-Arginine and D-ornithine metabolism
fpla01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpla00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    A4U99_15115
Enzymes [BR:fpla01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.5  D-ornithine 4,5-aminomutase
     A4U99_15115
SSDB
Motif
Pfam: Lys-AminoMut_A OAM_dimer B12-binding
Other DBs
NCBI-ProteinID: ANU42315
UniProt: A0A1C7FQU1
Position
3129377..3131593
AA seq 738 aa
MSEMTLKPNEKLDVRNILKDLDKYEPKRRGWTWRKPAPNLEMGPFTYHDVSEPLKQSVGL
PPAKYFGDIDPQPLPVITTEIASGRFEDDIRRMRMAAWHGADHIMVIRHMGQSHIDGLME
GTPQGIGGVPITRKQVRAQRKALDLIEEEVGRPINYHSYVSGVAGPDVAVMFAEEGINGA
HQDPQYNVLYRDINCVRSFVDACESKSIMAWAGMLQIDGAHNANATAREAWKVMPELIVQ
HAINSLFSERVGMKPENISLSTVPPTATPAPCVYTDLPYAVALRDICGRYKMRAQQNTKY
ICSSTREATVTHVLNMLISKLTSADIQSTITPDEGRNVPWHIYNIEAIDNAKQTLIGLDG
LMEMVELKKDGPLREMARELKERACLFMEEIVEVGGYFNAVQEGFFVDSAKYPERNGDGI
ARKIEGGVGYGYIFERAEDYMAPVTAHYGYNNVEQYGGDPANPSALIGGCTFEDRSKIVY
IDELDEEDNVNVRMDKVKKYLDGEALKPEVEWCADGTILLTMCIPAEKRVAEAAALEIGK
RLGLDHPEVISKEVLQEAEGTRIEMKGKLTFDVDPTKLEVPPEPHHLSDAVLYKEFEEHP
MVVVCGTVGEDEHSVGLREIINIKHGGIEKWGVKVHYLGTSVPVEKLVDAAVELNANAIL
ASTIISHDNVHYKNMKRINELAVEKGIRDRVIIAAGGTQVIPDEAVKTGIDQGFGRDSHG
IDVATFLAEEAMRRRGEL
NT seq 2217 nt   +upstreamnt  +downstreamnt
atgtctgagatgaccctgaagcccaacgaaaagctggatgtacgcaacatcctcaaggat
ctggacaagtacgagcccaagcgccggggatggacctggcgcaagcccgcccccaacctg
gagatgggcccctttacctaccacgatgtgtccgagccgctgaagcagagcgtcggcctt
cccccggccaagtacttcggcgatatcgacccccagccgcttccggtcatcacgaccgag
attgcctccggccgctttgaggacgatatccgccgcatgcgcatggccgcctggcacggc
gccgaccacatcatggtcatccggcatatgggccagtcccatatcgacggcctgatggag
ggcaccccccagggaatcggcggcgttcccatcacccgcaagcaggtccgcgcacagcgt
aaggcgctggatctcatcgaggaggaggtgggccgccccatcaactatcactcctatgtc
tccggtgtagctggccccgatgtggccgtcatgtttgccgaggaaggcatcaatggcgcc
caccaggatccccagtataacgtcctctaccgcgacatcaactgcgtgcgctccttcgtg
gacgcctgcgagtccaagtccattatggcctgggccgggatgctgcaaattgatggcgcc
cacaacgcaaacgccaccgcccgggaggcgtggaaggtcatgcctgagctgatcgtgcag
catgccatcaattccctgttctccgagcgggtgggcatgaagccggagaacatcagcctg
tccaccgtgccccccacggccactccggccccctgcgtctataccgacctgccctacgcc
gtggcgctgcgggacatctgcgggcgctacaagatgcgggcccagcagaacacgaagtac
atctgctcctccacccgcgaggcgacagtgacccacgtgctgaacatgctcatttcaaag
ctgaccagcgcggacatccagtccaccatcacccctgacgagggccgcaacgtcccctgg
cacatctacaatatcgaggccatcgacaacgccaagcagaccctcatcggtctggacggc
ctgatggagatggtggagctgaaaaaggacggccctctgcgcgagatggcccgtgagctc
aaggagcgcgcctgcctgttcatggaggagatcgtggaggtcggcggctacttcaacgcc
gttcaggagggcttcttcgtggactccgccaagtaccccgagcgcaacggcgacggcatc
gcccgcaagattgagggcggcgtgggctacggatacatctttgagcgggccgaggactac
atggcccccgtcactgcccactacggctacaacaacgtggagcagtacggcggcgatccg
gccaacccctccgccctgattggcggctgcacgtttgaggaccgcagcaagatcgtctac
atcgacgagctggatgaggaagacaacgtgaacgtccgtatggacaaggtaaagaagtat
ctggacggagaggccctcaagcccgaggtggagtggtgcgccgacggcaccatcctgctg
accatgtgtatccccgctgagaagcgtgtggccgaggcggcggccctggagatcggcaag
cggctgggtctggatcaccctgaggtgatcagcaaggaggttcttcaggaggcggagggt
acccgcatcgagatgaagggcaagctgaccttcgacgtggatcccaccaagctggaggtc
ccccccgagccccaccatttgagtgacgccgtgctttacaaagagttcgaggagcacccc
atggtggtggtctgcggcacggtaggcgaggatgagcactctgtgggcctgcgggagatt
atcaatatcaagcacggcggcattgaaaagtggggggtcaaggttcactacctgggcacc
tccgtcccggtggaaaagctggtggacgcggcggtggagctgaacgccaacgccattctg
gcctccaccatcatctcccacgataacgtccactacaagaatatgaagcgcatcaatgag
ctggcggtggaaaagggcatccgtgaccgggtaatcatcgccgccggcggcacccaagtc
atcccggatgaggccgtcaagaccggcattgaccagggcttcggccgggattcccacggg
atcgacgtggccaccttcctggcagaggaggccatgcgccggagaggtgagctgtaa

DBGET integrated database retrieval system