KEGG   Francisella philomiragia O#319-036: LA56_1468Help
Entry
LA56_1468         CDS       T03618                                 

Gene name
ackA
Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
fpm  Francisella philomiragia O#319-036
Pathway
fpm00430  Taurine and hypotaurine metabolism
fpm00620  Pyruvate metabolism
fpm00640  Propanoate metabolism
fpm00680  Methane metabolism
fpm01100  Metabolic pathways
fpm01120  Microbial metabolism in diverse environments
fpm01200  Carbon metabolism
Module
fpm_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:fpm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    LA56_1468 (ackA)
   00640 Propanoate metabolism
    LA56_1468 (ackA)
  09102 Energy metabolism
   00680 Methane metabolism
    LA56_1468 (ackA)
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    LA56_1468 (ackA)
Enzymes [BR:fpm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     LA56_1468 (ackA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase ROK Glucokinase
Motif
Other DBs
NCBI-ProteinID: AJI55408
Position
1517054..1518208
Genome map
AA seq 384 aa AA seqDB search
MSYILVLNCGSSSVKFALMNPQNSKSLVTGLAENIGASNCKITFKTQQKVQKHIENGEYK
DVFELLKDFLVENNYLEKISAIGHRVVHGGQYFSKSVIIDKDSLQRIKDCIPLAPLHNPA
HIEGILFCQQIFPNLPQVAVFDTAFHQTMPEYVAEYAIPRELTCEHNIRKYGAHGTSHKY
VSQQAAKILNKDVANVIVAHLGNGCSITAVVNGKSIDTSMGLTPLDGLVMGTRSGGIDPS
VFAYISDNLGWSIADITNMLNKKSGLLGICGHSDMREVSELADNGDKLAKLAIEVFCHRI
AKFVGSYMIYFKEFDGLVFTGGIGENATNIRKSVASNLANIGFEIDDAKNMKSETFINAG
NSHNIMVIATNEELMIAQETQNLI
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgtcatacatattagtcttaaactgtggaagttcatcagtcaaatttgcactgatgaat
ccccaaaactcaaaatcacttgttacaggtcttgccgagaatattggagctagcaactgt
aagataacttttaaaactcaacaaaaagttcagaagcatatagaaaatggtgagtacaaa
gatgtatttgagcttttaaaagattttttagtagagaataattatttagaaaaaatttct
gcgattggtcatagggtggttcatggaggtcagtatttttcaaaatctgtaattatagac
aaagattcattacagaggataaaagattgtatacctctagcgcctttacataatccagca
catattgaagggatactgttttgtcagcaaatattccctaacttacctcaagtagcagta
tttgatacagcatttcaccaaactatgcctgagtacgtcgcagaatatgcgatacctaga
gagctgacatgtgagcataacatacgtaaatatggcgcccatggaacttcacataaatat
gtttctcaacaagcagcgaaaatattaaataaagatgttgctaatgtgatagttgctcac
ttaggtaatggttgtagtatcacagctgttgttaatggtaaaagtattgatacaagtatg
gggcttactccattagatggacttgtcatgggaactcgttctggcggtatagatcctagt
gtttttgcatatatttcagataatcttggctggagtattgcagatatcacaaatatgcta
aacaaaaaaagtggcctattaggaatctgtggtcatagtgatatgcgagaggtttctgag
cttgctgataatggcgataaactagctaagctagctattgaagtattttgtcataggatt
gccaagtttgttggtagttatatgatttattttaaagagtttgatggtttggttttcaca
ggaggcattggtgagaatgccactaatattcgcaaaagtgtagcttctaatttagcgaat
ataggctttgaaatagatgatgctaaaaatatgaaatcagaaacatttataaatgcaggg
aatagtcataatataatggttattgcaactaatgaagagctaatgatagctcaagaaaca
caaaatttgatataa

DBGET integrated database retrieval system