KEGG   Francisella philomiragia O#319-036: LA56_1573Help
Entry
LA56_1573         CDS       T03618                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
fpm  Francisella philomiragia O#319-036
Pathway
fpm00670  One carbon pool by folate
fpm00790  Folate biosynthesis
fpm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    LA56_1573 (dfrA)
   00670 One carbon pool by folate
    LA56_1573 (dfrA)
Enzymes [BR:fpm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     LA56_1573 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 Imm26
Motif
Other DBs
NCBI-ProteinID: AJI55774
Position
complement(1634408..1634905)
Genome map
AA seq 165 aa AA seqDB search
MISLIVAYDKNLGIGKENTLAWKLSEDLKNFKKITENNYIVMGRKTFESIGRPLPNRKNI
ILTRDKDYKQDKCLIINSVQEILNFAQSKPHYEIFIIGGAQIYKEFLQYADRLYITEVDT
EMSDLDAFFPKWDKSKYKRIGHKQFKKDDKNEFDFTFAVYEKASA
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgatttcattaatagttgcttatgacaaaaatctaggtataggtaaagaaaatactcta
gcatggaaactttctgaagacctgaaaaacttcaaaaagataaccgagaataattatatt
gtaatgggtagaaaaacttttgagtcaatcggtcgccctctgccaaaccgtaaaaacatt
atcttaactagagataaagattataagcaggataagtgtttaataattaacagtgttcaa
gaaattctaaacttcgcgcaatcaaaacctcattatgagattttcataattggtggtgct
cagatttataaagaatttttgcaatatgccgatagactatacataactgaagtcgataca
gaaatgagtgatcttgatgctttctttcctaagtgggacaaatccaaatacaaacgcata
ggccataaacaattcaaaaaagatgataaaaacgagtttgacttcacgtttgccgtatat
gaaaaagcctctgcttaa

DBGET integrated database retrieval system