KEGG   Fictibacillus phosphorivorans: ABE65_004705Help
Entry
ABE65_004705      CDS       T04282                                 

Definition
(GenBank) 4-hydroxyphenylacetate 3-hydroxylase
  KO
K16901  anthranilate 3-monooxygenase (FAD) / 4-hydroxyphenylacetate 3-monooxygenase [EC:1.14.14.8 1.14.14.9]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00350  Tyrosine metabolism
fpn00380  Tryptophan metabolism
fpn01100  Metabolic pathways
fpn01120  Microbial metabolism in diverse environments
fpn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    ABE65_004705
   00380 Tryptophan metabolism
    ABE65_004705
Enzymes [BR:fpn01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.8  anthranilate 3-monooxygenase (FAD)
     ABE65_004705
    1.14.14.9  4-hydroxyphenylacetate 3-monooxygenase
     ABE65_004705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HpaB_N HpaB
Motif
Other DBs
NCBI-ProteinID: ANC76146
UniProt: A0A160IK35
Position
912825..914312
Genome map
AA seq 495 aa AA seqDB search
MGIRTGAQYIQALQSRSPEIWLEGRRITNVVSEPVFKQPIQEIAKLYDMQHDPQYQDSIT
HICKETGERVNNAFLHPTTYEELMARSELFEIYAKSTFGLMGRTPDFLNVVVTGMAHNGW
FLDQYNPEWSVNIKNYFNYIRDNDLFLTHAIINPQNDRSKNSHGQKDMFTHLGAVEETPD
GLIVRGAKMLATLAPITDEVIIYSFPGFAPGDERYALAFAVPVDTPGLKLICREPMQDGK
RSQFDHPLASRFEEMDALLVFNDVLVPWDRVFLYNNVEAANLLYPKTGIAQQPAHQSGVR
GYVKLAFATEVACKLADSIGVDGYLNVQNDLGELVQNVEVIRSLLRVAEYEFETTASGEV
MPNAAALETIRGMLPKMYPRAIEVIQIIGAGGLLMSPTGNDFNAPEIRSEIDKYYLGRDG
VDSLERVKLFKLAWDLCGEAFGQRLVQYERYYTGDPIRKRAIFYNGYKRKAKFSMVDEAL
SVTNEFVKDQPKLAK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggaattagaactggtgctcaatatattcaagcattacaatctcgttcaccagaaatt
tggttagagggcaggagaataactaatgtagtgagtgaacctgtttttaagcagccaatt
caagagatcgcgaaattgtacgatatgcagcacgatccgcaatatcaagattccattaca
catatttgcaaagagacgggtgagcgagtcaacaacgcgtttttacacccgacaacctat
gaagaattgatggcaagaagcgagttgtttgaaatctacgcaaaatctacttttgggcta
atgggccgaactcccgacttcctgaacgtcgttgtaacaggtatggcacacaatggctgg
ttcctcgatcaatacaatccggaatggtctgtaaatataaaaaactactttaactacata
cgagacaatgatttgtttttaacacatgcaatcattaacccgcaaaacgaccgaagtaaa
aactcacatggacaaaaggatatgttcactcatctaggtgctgttgaagaaacgcctgat
ggtttgatcgttaggggagcaaaaatgctggcaactctagcaccgattacagatgaagtc
atcatctactcgttcccaggcttcgcacctggagacgagcgatatgcccttgcttttgca
gtgcctgtggatacgccagggcttaaacttatttgccgtgaaccgatgcaggacggtaag
cgatcacagtttgatcatccccttgcttcgagatttgaagagatggatgctttgctcgtc
tttaatgacgtacttgtcccttgggatcgcgtgtttctttataacaacgtggaagcagct
aaccttttgtatccgaagacaggcattgcccagcagcctgctcatcagtcaggtgtaaga
ggatatgtgaaactagcatttgcaacagaagtcgcttgtaagctagcagactcaattggt
gtagatggatacttgaatgtacaaaacgacttaggtgaacttgtacagaacgtggaggtt
attcgatctttattacgagtagctgaatatgaatttgaaacaactgcgtctggtgaagta
atgccgaatgcagcggcgcttgagacgatcagaggcatgcttcctaaaatgtatccaaga
gcgatcgaggtcattcagatcattggtgctggtgggttgcttatgtcaccgactgggaat
gactttaacgctccagaaatccgaagtgagatagataagtactatttagggcgtgatggt
gtggattctcttgaacgcgttaagctgttcaagcttgcatgggatctgtgcggagaagct
tttgggcagcgacttgtacaatatgagcgctattatacgggagatccaatccgtaagaga
gccattttctacaacggttataaaagaaaagcgaagttctctatggttgatgaagcactt
tccgtaacaaatgaattcgtgaaggaccagcctaagctggctaaataa

DBGET integrated database retrieval system