KEGG   Fictibacillus phosphorivorans: ABE65_008560Help
Entry
ABE65_008560      CDS       T04282                                 

Definition
(GenBank) succinate--CoA ligase subunit alpha
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00020  Citrate cycle (TCA cycle)
fpn00640  Propanoate metabolism
fpn00660  C5-Branched dibasic acid metabolism
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
Module
fpn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fpn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ABE65_008560
   00640 Propanoate metabolism
    ABE65_008560
   00660 C5-Branched dibasic acid metabolism
    ABE65_008560
Enzymes [BR:fpn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     ABE65_008560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 Met_synt_B12
Motif
Other DBs
NCBI-ProteinID: ANC76848
UniProt: A0A160IKW2
Position
1667784..1668698
Genome map
AA seq 304 aa AA seqDB search
MSIFINKDTKVIVQGITGSVGLFHTKQMLEYGTKIVGGVTPGKGGTEVEGLPVFNTVVDA
VKETGANASVIYVPPAFAAEAIIEAVDAELDLAICITEGIPVLDMVKVKRYMEGKKTRLV
GPNCPGVITPEECKIGIMPGYIHTKGHVGVVSRSGTLTYEAVHQLTERGIGQSTAVGIGG
DPVNGTDFIDVLKAFNEDEDTYAVIMIGEIGGTAEEEAAEWVKANMKKPVVGFIGGQTAP
PGKRMGHAGAIISGGKGTADEKIKTMKACGIKVAATPSVMGETLVEALKENDLYDRCVTN
KAKA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcatttttattaataaagatacaaaagttatcgttcaaggtattacaggttctgtt
ggtcttttccatacaaaacaaatgcttgaatatggtacgaaaattgtaggcggtgttaca
ccaggtaaaggtggaacagaagttgaaggtcttcctgtttttaacaccgtagtggatgca
gttaaagaaactggagcgaacgcttctgttatctatgttccgccagcatttgctgcagaa
gcgatcattgaagcggttgacgcagaacttgatctagcaatctgtattactgaaggtatt
ccagtgttggatatggtaaaagttaagcgctacatggaaggcaagaagactcgtctagtt
ggtccgaactgcccgggtgtaatcactcctgaagaatgtaagatcggtatcatgccagga
tacattcatacaaaaggtcatgttggggttgtgtcacgttctggtacattaacgtatgaa
gctgttcaccagctgacagagcgtggaatcggtcaatctacagcagtaggtatcggggga
gacccagtcaacggaactgactttatcgacgttttaaaggcatttaacgaagatgaggac
acatatgcagtaatcatgatcggtgagatcggtggaacggctgaagaagaagctgctgaa
tgggttaaagcgaacatgaagaaacctgtagtaggattcatcggtggacaaactgcacct
ccaggaaaacgaatgggccatgctggtgcgatcatctctggtggtaaaggtacggcagat
gagaagatcaaaacgatgaaagcttgtggaattaaagttgcagcaacgccttctgttatg
ggagaaactttagttgaagctttgaaagaaaacgatctatatgatcgctgtgtaacaaat
aaagcaaaagcgtaa

DBGET integrated database retrieval system