KEGG   Fictibacillus phosphorivorans: ABE65_009230Help
Entry
ABE65_009230      CDS       T04282                                 

Definition
(GenBank) selenophosphate synthetase
  KO
K01008  selenide, water dikinase [EC:2.7.9.3]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00450  Selenocompound metabolism
fpn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABE65_009230
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpn03016]
    ABE65_009230
Enzymes [BR:fpn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.9  Phosphotransferases with paired acceptors
    2.7.9.3  selenide, water dikinase
     ABE65_009230
Transfer RNA biogenesis [BR:fpn03016]
 Eukaryotic Type
  tRNA modification factors
   Other tRNA modification factors
    ABE65_009230
 Prokaryotic Type
    ABE65_009230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AIRS_C AIRS
Motif
Other DBs
NCBI-ProteinID: ANC76974
UniProt: A0A160ILM6
Position
complement(1803305..1804270)
Genome map
AA seq 321 aa AA seqDB search
MRHLPKSEYDPNLLVGLDTSDDAGVYKLTDDLAMIQTVDFFTPIVDDPYMFGQIAAANSL
SDVYAMGGRPTTVMNIVGFPINTLGHDVLAEILKGAADKVKESGAVLVGGHSIDDSEPKF
GLSVTGLVHPSKVYKNVGARPGDVLVLTKPIGVGIQTTAIKKDKLTVDQLQLVSETMAAL
NKTAAECLEGLSPNAVTDVTGFGLLGHATEMAKGTGDITIEIDYDRVPLLPGTTELAQEG
IVPGGSKANHRWIKDDVQYGNEISQWQQWILCDAVTSGGLLVSLSESEAREYVERLHKNG
INDASIVGRVLSFSQKPIKAN
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
ttgcgccatctaccaaaaagcgaatatgatcctaaccttttagttggtttagatacttca
gacgatgcaggagtctataagttaacggatgaccttgctatgatccagactgtcgacttc
tttacgccaatcgtagacgatccatacatgttcggccagattgctgctgccaattcactt
agtgatgtatacgcgatgggaggacgacctacaacagtaatgaatatagtaggttttccg
atcaacactctaggtcacgatgttctcgctgagatcttaaagggtgctgccgataaagtg
aaagaatctggcgcagtgcttgtcggaggacactcgattgacgattcagagcctaagttc
ggtctgtctgtaactggcctcgttcatccatcaaaagtatacaaaaatgttggtgcgaga
cccggagatgttcttgtgttaaccaaaccaatcggtgtgggtatacaaaccacagcgata
aaaaaagacaagcttaccgtcgatcagcttcagctcgtcagcgaaacgatggcagcattg
aataagactgctgctgaatgtttagaaggtctatctcctaacgctgttacagatgtaact
ggatttggtctccttggtcatgcgactgagatggcaaaaggaactggagatattacaatc
gagatcgattatgaccgagtaccactcttaccaggcactacagagcttgctcaagaagga
atcgttcctggtggttctaaagccaatcatcgttggatcaaagatgatgtccaatacgga
aacgaaatttcccagtggcagcaatggatattatgtgacgctgtaacttctggcggttta
ctcgtaagtctttctgaaagtgaagcaagagaatacgtggagagacttcataaaaatggc
attaatgacgcaagtatcgtcggtcgtgttctttcattctcacaaaaaccgatcaaagcc
aattaa

DBGET integrated database retrieval system