KEGG   Fictibacillus phosphorivorans: ABE65_013510Help
Entry
ABE65_013510      CDS       T04282                                 

Definition
(GenBank) beta-ketoadipyl CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00071  Fatty acid degradation
fpn00072  Synthesis and degradation of ketone bodies
fpn00280  Valine, leucine and isoleucine degradation
fpn00310  Lysine degradation
fpn00362  Benzoate degradation
fpn00380  Tryptophan metabolism
fpn00620  Pyruvate metabolism
fpn00630  Glyoxylate and dicarboxylate metabolism
fpn00640  Propanoate metabolism
fpn00650  Butanoate metabolism
fpn00900  Terpenoid backbone biosynthesis
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
fpn01212  Fatty acid metabolism
fpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE65_013510
   00630 Glyoxylate and dicarboxylate metabolism
    ABE65_013510
   00640 Propanoate metabolism
    ABE65_013510
   00650 Butanoate metabolism
    ABE65_013510
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE65_013510
   00072 Synthesis and degradation of ketone bodies
    ABE65_013510
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE65_013510
   00310 Lysine degradation
    ABE65_013510
   00380 Tryptophan metabolism
    ABE65_013510
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE65_013510
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE65_013510
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE65_013510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpn04147]
    ABE65_013510
Enzymes [BR:fpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABE65_013510
Exosome [BR:fpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABE65_013510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ACP_syn_III_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ANC77761
UniProt: A0A160IN74
Position
complement(2610339..2611508)
Genome map
AA seq 389 aa AA seqDB search
MAIYIIEGARTPFGSYGKSLTGVSPTDLGEISAVEAMKRAHISPADITDVVYGNVIHSSK
NAAYVARHTALRAGVPSDVPAMLVNRLCGSGMQAVVSSMQNLRDQEEGIALCGGIENMSQ
SPHVSFHHRFHNQKFGPITFDDMLLQTLSDEYIGCGMGITAENLADQYSITRGEQDEYAS
LSHRKAAEARESGRFTKEIVSVPLKNGALFTEDEGIKPETSVSLLGELRPSFQKDGTVTA
GNSSSINDGAVSLILAHEKSVKEKRLKPLVKIVSWAVTGVDPSVMGIGPVPAIQKLLQKT
GLSIDDIGLFEINEAFSSQYLAVEKELKLDRERTNVNGGAIALGHPVGASGARLLLTLSY
EMEQRQEKYGIASLCIGGGQGIAMLLKRV
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggctatctatatcatagaaggggctagaacgccgtttggatcatatggaaaatccttg
acaggtgtgagtccgacagacctgggtgagatatctgcggtagaggcgatgaaacgtgcc
catatttctccagcagatataacggatgtcgtttatggtaatgttattcattcgagcaag
aatgccgcatatgtagcgcggcatactgcattaagagcaggagtgccatcagacgttcct
gccatgctcgtcaaccgcttatgtggttctggcatgcaagcagtggtttcatccatgcag
aacctacgtgatcaggaagaaggaattgcactttgtggaggcatagaaaatatgtcacag
tcgccacacgtttcttttcaccaccggtttcataatcaaaagtttggcccgatcacgttt
gatgatatgcttcttcagacgttaagtgatgaatacatcgggtgtggtatgggtattaca
gctgaaaatttagctgatcaatattccattacaagaggagagcaagatgagtatgcaagt
cttagtcatagaaaagcggctgaagcaagagagagtggaagatttacaaaagagatcgtt
tcagtacctttaaaaaacggtgctctttttacagaggatgaaggaatcaaaccagaaaca
tctgtttctttgcttggagaattgaggccgtcttttcaaaaagacggaacagttacagca
ggaaattcttcttctattaacgatggggccgtgtcacttattcttgctcacgaaaaatcg
gttaaagagaaaaggttaaaaccgcttgtaaagattgtttcttgggcagtaacaggcgtc
gatccatcagtgatgggaattggtcctgtacctgcgattcaaaaactcctgcaaaaaaca
ggtctttccatcgacgacattgggttgtttgaaattaacgaagcgtttagttctcaatat
ttagctgtagaaaaggaactaaagttagaccgcgaaagaacgaatgtaaacggaggagcg
attgcgctaggccaccctgtaggtgcgagtggtgctaggttgctgctcactctaagttat
gaaatggaacagcgccaagaaaagtacggaatagcgagcctctgtattggcggtgggcaa
ggaattgcgatgttactcaaacgagtataa

DBGET integrated database retrieval system