KEGG   Fictibacillus phosphorivorans: ABE65_013525Help
Entry
ABE65_013525      CDS       T04282                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00071  Fatty acid degradation
fpn00072  Synthesis and degradation of ketone bodies
fpn00280  Valine, leucine and isoleucine degradation
fpn00310  Lysine degradation
fpn00362  Benzoate degradation
fpn00380  Tryptophan metabolism
fpn00620  Pyruvate metabolism
fpn00630  Glyoxylate and dicarboxylate metabolism
fpn00640  Propanoate metabolism
fpn00650  Butanoate metabolism
fpn00900  Terpenoid backbone biosynthesis
fpn01100  Metabolic pathways
fpn01110  Biosynthesis of secondary metabolites
fpn01120  Microbial metabolism in diverse environments
fpn01130  Biosynthesis of antibiotics
fpn01200  Carbon metabolism
fpn01212  Fatty acid metabolism
fpn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ABE65_013525
   00630 Glyoxylate and dicarboxylate metabolism
    ABE65_013525
   00640 Propanoate metabolism
    ABE65_013525
   00650 Butanoate metabolism
    ABE65_013525
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ABE65_013525
   00072 Synthesis and degradation of ketone bodies
    ABE65_013525
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ABE65_013525
   00310 Lysine degradation
    ABE65_013525
   00380 Tryptophan metabolism
    ABE65_013525
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ABE65_013525
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ABE65_013525
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ABE65_013525
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpn04147]
    ABE65_013525
Enzymes [BR:fpn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ABE65_013525
Exosome [BR:fpn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ABE65_013525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt SpoVAD
Motif
Other DBs
NCBI-ProteinID: ANC77764
UniProt: A0A160INH1
Position
complement(2613006..2614205)
Genome map
AA seq 399 aa AA seqDB search
MVSRERDAVVVSAVRTPIGSFMGSFKTVAATELGAIAIKDALKKAGVPKDSVDEVIMGNV
LQAGLGQNPARQAAIKAGLPNEVSSMTINKVCGSGLKAIHLACQAIWLDEADIIVCGGME
NMSQAPYLLNGARDGLRMGNAPMVDSMIQDGLWCAFGDYHMGITAENLCETHSLSRDELD
EFAAESQRKCAQAQEQGKFNDEITPVEIPQRKGDPIIVDTDEYPKPSSTAEKLGKLRPAF
KKDGMVTAGNASGINDGAAALVVMSRKKAEELGLKPIAVVKANASAGVAPEVMGIGPVEA
VKKVLRKTELSMSDFDLVEANEAFASQSLAVGKDLEFDKEKLNVNGGAIALGHPIGASGA
RIVVTLLHEMKRRNAKRGLATLCIGGGQGVASIFENEAE
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggtttcaagggagagagatgctgtagttgtaagcgctgtcagaacaccgatcggaagc
tttatgggaagctttaaaacggttgcggcaacagaattaggagcgatcgcgatcaaagat
gcattgaaaaaagctggtgtcccgaaggattcagtagatgaagtcatcatgggcaatgtg
ctgcaagcaggcctcggacagaacccagcccgacaagctgctattaaagctggtttaccg
aacgaggtatccagtatgacgattaataaagtgtgcggttcaggtctcaaggcgatccat
ctagcgtgccaagcgatctggctggatgaagcagatattatcgtttgcggtggaatggaa
aacatgagccaagctccttatcttttgaacggggcgagagatggtctccgaatgggtaac
gctccgatggtagattccatgattcaagacggattatggtgtgcatttggtgattatcat
atgggaatcactgcagaaaatttatgcgagacgcattcattgtcccgtgacgagctggat
gagtttgcagcagaaagccaaagaaaatgtgcacaagcacaagaacaaggaaaatttaat
gacgagatcacaccggtagagattcctcaacgtaaaggtgatccgattattgttgataca
gatgaatatccaaaaccaagttcaacggctgaaaagctagggaagctacgccctgcgttc
aagaaagatggaatggtaacagcaggtaacgcatcaggcatcaatgatggtgcagcagca
cttgttgtgatgagccgaaagaaagcagaagaactaggattgaaaccaattgccgttgta
aaagcgaatgcgagcgctggtgttgcgccagaagtaatgggaatcggaccagtggaagcg
gttaaaaaagtgttaagaaagacagagttgagcatgtctgattttgacttggttgaagca
aatgaagcatttgcgagtcaatctctagcggttggcaaggatcttgaatttgataaagaa
aaattaaatgtaaacggtggagcgatcgcacttgggcatccgatcggagcaagcggtgca
agaatcgttgtgacattgcttcatgagatgaaacgcagaaacgccaaacgaggccttgcg
acgctttgtatcggtggtggccaaggggtagcgtcaatttttgagaacgaagcagaataa

DBGET integrated database retrieval system