KEGG   Fictibacillus phosphorivorans: ABE65_016620Help
Entry
ABE65_016620      CDS       T04282                                 

Definition
(GenBank) HAD family hydrolase
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00627  Aminobenzoate degradation
fpn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ABE65_016620
Enzymes [BR:fpn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     ABE65_016620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 Hydrolase_3 DUF4136
Motif
Other DBs
NCBI-ProteinID: ANC78333
UniProt: A0A160IPI7
Position
complement(3233449..3234216)
Genome map
AA seq 255 aa AA seqDB search
MKAYKGFLIDLDGTMYRGTERIIEAVDFVKKLNEKNLPYLFVTNNSSKTKKQVADVLAGF
DIPASAEHVYTTSMATANYIAEQKKNATVYCIGEDGIREALQEQGLELVEENPDFVVVGI
DRSITYEKLAKACLAVRNGATFISTNGDIALPTERGLLPGNGALTSVITVSTQTEPTFIG
KPESIIMEMALETLGMKKEETLMIGDNYQTDILAGIRAGIDTLLVHTGVTTKKHLEEIEV
HPTYTVNGLDEWEIK
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcatataaaggattcttgatcgacttagacggaacgatgtatcgaggaacagaa
cgaattattgaggcggttgattttgtaaaaaaattaaacgaaaaaaaccttccttatttg
ttcgtgacaaataattcttctaaaacaaaaaaacaagtggcagatgtgcttgcaggattt
gatatcccagcatctgctgaacatgtgtatacaacgagcatggcaacagccaactatatt
gctgaacaaaagaaaaatgcgaccgtctattgtatcggtgaggatggaattagagaagcg
cttcaagaacaaggactagaactagtagaagagaaccctgattttgttgtggttggaatc
gatcgctcgatcacctatgaaaagttagcaaaagcatgccttgcagtccgtaacggagca
acttttatctcgacaaatggtgatattgctcttccgacggaaagaggccttctgccagga
aacggagcactgacttctgtcattacggtttcaactcaaacagaaccaacgtttatcggt
aagcctgagtccatcatcatggagatggcgttagaaacactcggaatgaaaaaagaagaa
acactcatgatcggtgacaactatcaaacagatatcttagctggtattcgtgccggaatc
gatacgctgcttgttcacacaggagttacaacaaagaaacaccttgaagaaattgaggtt
catccaacgtataccgttaacggattggatgagtgggagatcaagtaa

DBGET integrated database retrieval system