KEGG   Fictibacillus phosphorivorans: ABE65_016680Help
Entry
ABE65_016680      CDS       T04282                                 

Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
fpn  Fictibacillus phosphorivorans
Pathway
fpn00670  One carbon pool by folate
fpn00790  Folate biosynthesis
fpn01100  Metabolic pathways
Module
fpn_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:fpn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    ABE65_016680
   00670 One carbon pool by folate
    ABE65_016680
Enzymes [BR:fpn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     ABE65_016680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 Dirigent
Motif
Other DBs
NCBI-ProteinID: ANC78344
UniProt: A0A160IPS7
Position
complement(3244489..3244965)
Genome map
AA seq 158 aa AA seqDB search
MISFVVAMDENRAIGKDNDLPWYLPNDLKHFKNVTMGKPIVMGRKTYESIGKPLPGRENI
VVTRDEHYKAEGTTVVHSVDEVLKKETEELCVIGGTEIFKLFMSVADRLYVTEIHHTFDA
DTYFPEINRDEWMEVSRKPGIVDEKNKYPHDFVVYEKN
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatctcgtttgttgtagcgatggatgaaaatcgcgcgatcgggaaagacaatgatctt
ccatggtacttaccaaatgatcttaagcactttaagaacgtaacgatgggaaaaccgatc
gtgatgggcagaaaaacgtatgaatccatcggtaagcctctacctggacgagaaaatatt
gtggtaacgagagatgaacactataaagctgaaggaacgactgtggttcattctgttgat
gaagtcctaaaaaaagaaacagaagaactatgtgtgattggtggaactgagatttttaag
ttgttcatgtcagttgcagaccgtctatatgttacagagattcaccatacatttgacgca
gatacgtattttcccgagatcaatcgtgatgaatggatggaagtctcacgtaaaccaggc
atcgtagatgaaaagaacaaatatccacacgattttgtcgtgtacgaaaaaaattaa

DBGET integrated database retrieval system