KEGG   Frischella perrara: FPB0191_00308Help
Entry
FPB0191_00308     CDS       T03525                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
fpp  Frischella perrara
Pathway
fpp00450  Selenocompound metabolism
fpp00970  Aminoacyl-tRNA biosynthesis
fpp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    FPB0191_00308
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FPB0191_00308
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fpp01007]
    FPB0191_00308
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpp03016]
    FPB0191_00308
Enzymes [BR:fpp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     FPB0191_00308
Amino acid related enzymes [BR:fpp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   FPB0191_00308
Transfer RNA biogenesis [BR:fpp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    FPB0191_00308
 Prokaryotic type
   Other AARSs
    FPB0191_00308
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f
Motif
Other DBs
NCBI-ProteinID: AJA44146
UniProt: A0A0A7S4D1
Position
complement(313284..315314)
Genome map
AA seq 676 aa AA seqDB search
MTDKRRILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGHEIYFICADDAHGTPIML
KAEQLGITPEQLIDQVKHEHLHDFTGFNISFDNYHSTHSPENRELSELIYDRLKNNGYIR
TKVISQLYDPEKQMFLPDRFVKGTCPKCKSPDQYGDNCEVCSATYSPIDLINPKSVISGA
TPIIKDSEHYFFDLPEFKAMLQDWIRSGSLQAQVANKMQEWFESGLQPWDISRDAPYFGF
EIPDAPGKYFYVWLDAPIGYMGSFKNYCDRTPHVSFNDFWQKDSTTELYHFIGKDIVYFH
SLFWPAMLEGSQYRKPSNIFVHGYVTVDGAKMSKSRGTFIQANTYLKYLDPDCLRYYYAA
KSSAAIDDIDLNLEDFVQRVNSDIVNKVVNIASRCAGFINKRFDGKLSQTVLDQDLYDLF
CQKSVIIGEYFEARELGKAIREIMALADEANRFIDEKAPWIVAKQEGQDQLLQDICSLGI
NFFRILMTYLTPVIPALSQRSESFLNTTLEWDTIGQPLINHSINKFKALFTRIEMTNIEQ
MIDETKSLLNTPTQPASTIEQQPIAETINFDDFAKIDLRVALIKEANLVEGSDKLLQLTL
DLGGEVRNVFSGIRSAYPDPKQLEGKLTVMVANLAPRKMRFGISQGMVLCASGKQDDDGL
YLLSPDCGAKPGMKIS
NT seq 2031 nt NT seq  +upstreamnt  +downstreamnt
atgactgacaaacgtagaattctggtaacgtgtgccctgccttatgcaaatggctcaatt
catttaggtcatatgcttgagcatattcaagccgacgtatgggttcgttatcaacgcatg
cgtggtcatgaaatctattttatttgtgctgatgatgcacatggcacaccaattatgctt
aaagcggaacaattaggtattacgcctgagcagttaattgatcaagttaagcatgaacac
ctccatgattttacaggttttaatattagttttgataattatcattcaacacatagtcct
gaaaaccgtgaactatctgaactgatttatgatcggttaaaaaataatggttacattaga
actaaggtcatttcacaactgtatgatcctgaaaaacagatgtttttacctgaccgtttt
gttaaaggtacctgccctaaatgtaaatcgcctgatcaatatggtgataactgcgaggta
tgtagtgcaacttatagtccaattgatttaattaatcctaaatctgttatttctggtgcg
acaccaattataaaagattccgagcattatttcttcgatttgccagagtttaaagctatg
ttgcaagattggattcgttctggttctttacaagcacaagttgctaataaaatgcaagaa
tggtttgaatcaggtttacaaccttgggacattagtcgtgatgcaccctattttggtttt
gaaattcctgatgctccaggtaagtacttttatgtttggttggatgcaccaattggctat
atgggatcttttaaaaattattgcgatcgaacgcctcatgtttcttttaatgatttttgg
caaaaagactccaccactgaattgtatcactttatcggcaaagacattgtttatttccat
agtttattttggcctgcaatgcttgaaggtagccaatatcgtaagcctagcaatatattt
gttcatggttatgttactgttgatggcgcgaaaatgtccaaatcaagaggtacattcatt
caagcgaatacttatctaaaatatctcgaccctgattgcttacgctactattatgcggct
aaatcatcagcagcaattgatgatatcgatcttaatcttgaagattttgtacaacgcgtt
aatagtgatatagtcaataaagtcgtaaacatagcttcacgttgtgccggtttcatcaat
aagcgtttcgatggtaaattatctcaaactgttttagaccaagacttgtatgatctattt
tgtcaaaaaagcgttattattggtgaatattttgaagcaagagaattaggtaaagccata
cgagaaattatggccttggccgatgaagcaaatcgttttattgacgaaaaagcgccttgg
attgtagctaagcaagaaggccaagatcagttattacaagatatctgttctttgggaatt
aatttcttccgtattcttatgacttaccttacaccagtaatcccggcgttaagtcaacgc
agcgaatctttcttaaacacaaccttagaatgggatactattggtcaaccattaataaat
catagtattaataaatttaaagcattatttactcgtattgaaatgacgaatattgaacaa
atgattgatgaaactaaatcactattaaataccccgactcaaccagctagtactattgag
caacaacctattgcagaaacaatcaattttgatgattttgccaaaattgatttgcgtgtt
gcattaatcaaagaagctaatttggtcgaaggttctgataaattattacaactaacacta
gacttaggtggtgaggttcgtaatgtattttctggaattcgtagtgcctatccagatcca
aaacaacttgaaggaaaattaactgttatggttgccaatcttgcaccacgtaaaatgcgg
tttggtatatcacaaggaatggtactatgtgctagcggtaaacaagatgatgatggttta
tatctattatctcctgattgtggtgctaaacctggtatgaaaattagctaa

DBGET integrated database retrieval system