KEGG   Frischella perrara: FPB0191_00683Help
Entry
FPB0191_00683     CDS       T03525                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpp  Frischella perrara
Pathway
fpp00071  Fatty acid degradation
fpp00280  Valine, leucine and isoleucine degradation
fpp00362  Benzoate degradation
fpp00380  Tryptophan metabolism
fpp00620  Pyruvate metabolism
fpp00630  Glyoxylate and dicarboxylate metabolism
fpp00640  Propanoate metabolism
fpp00650  Butanoate metabolism
fpp00900  Terpenoid backbone biosynthesis
fpp01100  Metabolic pathways
fpp01110  Biosynthesis of secondary metabolites
fpp01120  Microbial metabolism in diverse environments
fpp01130  Biosynthesis of antibiotics
fpp01200  Carbon metabolism
fpp01212  Fatty acid metabolism
fpp02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    FPB0191_00683
   00630 Glyoxylate and dicarboxylate metabolism
    FPB0191_00683
   00640 Propanoate metabolism
    FPB0191_00683
   00650 Butanoate metabolism
    FPB0191_00683
  09103 Lipid metabolism
   00071 Fatty acid degradation
    FPB0191_00683
   00072 Synthesis and degradation of ketone bodies
    FPB0191_00683
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FPB0191_00683
   00310 Lysine degradation
    FPB0191_00683
   00380 Tryptophan metabolism
    FPB0191_00683
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FPB0191_00683
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FPB0191_00683
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    FPB0191_00683
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fpp04147]
    FPB0191_00683
Enzymes [BR:fpp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FPB0191_00683
Exosome [BR:fpp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FPB0191_00683
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AJA44513
UniProt: A0A0A7RZ57
Position
770822..772000
Genome map
AA seq 392 aa AA seqDB search
MKKVVIVSATRTAIGHFNGSIASIDAIELGKIVIEDALKRIELDTSFVDEVIIGNVIQSG
LGQNPARQSALKANLSNNIPAFTINKVCGSGLKAITLAAQSILAGDNHIMIAGGMENMSQ
APYLINNKCRWNLNQGKNQLYDTLVNDGLYCSINHYHMGMTAEILAKMYDISRSDQDQFA
LRSHQLAQKAISNGEFIDEIVPITVKTGKEKYIFQQDQLPKFNLSLDHLSDLIPIFKKGT
VTTGNISNLSDGAAALIIMSENRAKQLGLRPLAYIRSYASGAVNPNLMGLGSVSATKLAL
KKASLNLSDIDLIEAGETFAAQFLALCYELDFDLSKTNIRGGTIALGHPIGSSGARILVT
LLYTMIHHDKQFGLATLGIGGGLGISIILERC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggtagtcattgttagtgcaacaagaacggcaatcggtcattttaatggttct
atagcatcaattgatgctatagaattaggaaaaattgtgattgaagatgcgttaaaaaga
attgaattagatactagttttgttgatgaagtaataatagggaatgttatacaatcaggt
cttgggcagaatcctgcgcgccagtctgcattaaaggctaatttatccaataatattcca
gcattcacaatcaataaagtttgtggaagtggacttaaagcaattaccttagccgcgcaa
agtattttggccggtgataaccatattatgatagccggtggaatggaaaatatgtcgcag
gcaccttatttaatcaataataaatgtcgctggaatctaaatcagggtaaaaatcagtta
tatgatacattagtaaatgatggtttgtattgttcaattaatcattatcatatgggaatg
accgcagaaattcttgccaaaatgtatgatattagtcgttctgatcaagatcaatttgca
cttcgttcgcatcaattagctcaaaaagcaataagtaatggtgaatttattgacgaaata
gtacccattactgtcaagacaggtaaagaaaaatatatttttcaacaagatcaattgccc
aaattcaacctcagtttagatcatttatctgatctaattccaatttttaaaaaaggaaca
gttacaaccggtaatatatcaaatcttagtgatggtgccgcagcattgattattatgtca
gaaaatagggctaagcaattaggtttacgccctttagcatatatccgtagctatgcatct
ggagcagtaaaccctaatttgatgggattaggatcggtatcagctactaaacttgcatta
aaaaaggcttcattaaatctgagcgatattgatttgattgaagcaggggaaacatttgca
gcacagtttttagcactttgttatgaattggattttgatctgagtaaaacaaatatccgt
ggtgggacaattgcactcggacaccctattggcagtagtggtgcgcgtattttagtgaca
cttctttatacgatgattcatcatgataaacaatttggacttgcaacattaggtatcggt
ggtgggttaggtatttctattatccttgaacgctgttag

DBGET integrated database retrieval system