KEGG   Frischella perrara: FPB0191_00962Help
Entry
FPB0191_00962     CDS       T03525                                 

Definition
(GenBank) Pseudouridylate synthase, 23S RNA-specific
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
fpp  Frischella perrara
Brite
KEGG Orthology (KO) [BR:fpp00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fpp03016]
    FPB0191_00962
Enzymes [BR:fpp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     FPB0191_00962
Transfer RNA biogenesis [BR:fpp03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    FPB0191_00962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AJA44788
UniProt: A0A0A7RZY0
Position
1089469..1090188
Genome map
AA seq 239 aa AA seqDB search
MIFDILYQDQNLIAINKPSGWLVHRSWLDRHEKVVIMQTLRDQIGQHVYPIHRLDRPTSG
VLLFALSSEVANLMAMQFAHHQPQKTYHAIVRGFIQQADTIDYPLVEELDKIADKFANQK
KPAQSAITHYKPLSKIEIPVAVGKFATARYSLVELKPLTGRKHQLRRHMKHIFHPIIGDS
KHGDLHQNRAFNRYFDVKRLMLHASELIFSHPINQKLLSIKAPFDQQWLTILEQFDNKD
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgatatttgatattctttaccaagatcaaaacctaattgccattaataaaccatctggt
tggttagtacatcgaagctggcttgatcgacatgaaaaagtcgtcatcatgcaaacatta
cgtgatcaaattggtcaacatgtctatccaattcatcgattagatcgtccaacttctggc
gtattactctttgcgctatcaagtgaagttgcgaatttaatggcaatgcaatttgcccat
catcaaccacaaaaaacctatcatgctattgttagaggttttattcaacaagctgatact
atcgactatcctcttgttgaggaattggataaaattgcggataaattcgccaatcagaaa
aaaccggctcaatctgcaattacccattataaacctttaagtaagatcgaaattccggtt
gctgtaggtaaatttgctacagctcgttatagcttagtagaattaaaaccactaactgga
cgtaaacaccaattacggcgacatatgaagcatatttttcatcccataattggggatagt
aagcatggtgatcttcatcaaaatagagcatttaaccgttattttgatgtgaaacgacta
atgctacacgcgagtgagctgatttttagccatccaatcaatcaaaagttattatcaatt
aaagccccgtttgatcagcaatggttaacgatattagaacaatttgataataaggattaa

DBGET integrated database retrieval system