KEGG   Flavobacterium psychrophilum 950106-1/1: IB65_06910Help
Entry
IB65_06910        CDS       T03412                                 

Definition
(GenBank) phosphoglycerate mutase
  KO
K02226  alpha-ribazole phosphatase [EC:3.1.3.73]
Organism
fpq  Flavobacterium psychrophilum 950106-1/1
Pathway
fpq00860  Porphyrin and chlorophyll metabolism
fpq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpq00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    IB65_06910
Enzymes [BR:fpq01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.73  adenosylcobalamin/alpha-ribazole phosphatase
     IB65_06910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AIT65605
UniProt: A0A075RG95
Position
complement(1493454..1493978)
Genome map
AA seq 174 aa AA seqDB search
MEIYLVRHTETVCEKGICYGQADVQIKPNYLSIFESIKNQIPKGAIVYSSSLKRCTILAN
YISSENYKTDSRLMEMNFGDWELKKWNDISLETMNPWMQDFVNVSVPNGESFIQLHKRVV
SFLNDLKQSNSSNPVVIITHAGVIRSVLCQIYNLPLQDAFQYKVDFGEVKKIKL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggaaatttatttagtacgtcataccgaaacagtttgcgaaaaaggtatttgttacggt
caagccgatgtacaaattaaacctaattatttatctattttcgaatctataaaaaatcaa
attcccaaaggcgctattgtatattcaagttctttaaagcgatgcacaatattagcaaat
tatatttcttctgaaaattacaaaacggattcccgattaatggaaatgaattttggcgat
tgggaattaaaaaaatggaatgatatttcgctagaaaccatgaatccttggatgcaagat
ttcgtaaatgtatctgtgccaaatggcgaatcatttatacaattacataaaagagtagtc
agttttttaaacgatttaaaacaatcaaattcatcaaatccagttgtcattattacgcat
gcgggtgttattcgaagtgttttgtgtcaaatttataatttaccacttcaagatgctttt
cagtataaagttgattttggcgaagtaaaaaagataaaattatga

DBGET integrated database retrieval system