KEGG   Faecalibacterium prausnitzii L2-6: FP2_06360Help
Entry
FP2_06360         CDS       T02591                                 

Definition
(GenBank) HAD superfamily (subfamily IA) hydrolase, TIGR02254
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
fpr01100  Metabolic pathways
fpr01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:fpr00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    FP2_06360
   00361 Chlorocyclohexane and chlorobenzene degradation
    FP2_06360
Enzymes [BR:fpr01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     FP2_06360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase_like Hydrolase HAD
Motif
Other DBs
NCBI-ProteinID: CBK98263
UniProt: D4K420
Position
623082..623822
Genome map
AA seq 246 aa AA seqDB search
MAKYYCILFDADNTLLDFDAAENKALAETLVEYGIEPDAGTVQTYRDINSELWRQLEKGQ
IRRDKLMGERFTRFLKAIDAAGDGAEMNRCYLDHLSSHPDLMTPNVPDVLGELSEVATLA
IVTNGFEKVQSRRVAESGIGAYLEDVFVSEKLDSEKPSRRIFDSALRALGVENREHVLVV
GDSLTSDIQGGVNAGLDTCWFNPGHAENPGKVSPTYEIASLEELYPLVMEPEELANLGLK
HRRHQL
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaatattattgcatcctcttcgatgcagacaatacgcttctggactttgacgcc
gccgagaacaaggcgctggctgagacgctggtggaatacggcatcgagccggacgccggg
acggtgcagacctaccgggacatcaactcggagctctggcgtcagctggaaaagggccag
atacgccgcgacaagctgatgggggagcgcttcacccgcttcctcaaggccatcgacgca
gccggtgacggcgcggagatgaaccgctgctacctcgaccacctgtcctcccaccccgac
ctgatgacccccaatgtgccggacgtcctcggggagctttccgaggtggcgacgctggcc
atcgtgaccaacggctttgagaaggtgcagagccgccgggtggcagaatccggcatcggg
gcctaccttgaggacgtcttcgtctccgagaagctggacagcgagaagcccagccgccgc
atcttcgactccgccctccgcgctctgggcgtggagaaccgagagcacgtcctggtggtg
ggcgacagcctcaccagcgacattcagggcggcgtgaacgcgggcctcgacacctgctgg
ttcaaccccggccacgccgagaacccgggcaaggtgagccccacctacgagatcgcctcg
ctggaagagctctacccgctggtgatggagccggaagagctggcgaacctcggcctcaag
caccgccgtcatcagctgtaa

DBGET integrated database retrieval system