KEGG   Faecalibacterium prausnitzii L2-6: FP2_14760Help
Entry
FP2_14760         CDS       T02591                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
fpr03010  Ribosome
Brite
KEGG Orthology (KO) [BR:fpr00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    FP2_14760
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:fpr03011]
    FP2_14760
Ribosome [BR:fpr03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    FP2_14760
  Bacteria
    FP2_14760
  Archaea
    FP2_14760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CBK98964
UniProt: D4JY65
Position
1457828..1458103
Genome map
AA seq 91 aa AA seqDB search
MDLIRNKPLDEALAILQYTPKAACEPLLKLVKSAAANAENNFNMDKNNLYVAECYVCPGP
TLKRMMPRAQGRGYRILKRTSHMTVVLKEKE
NT seq 276 nt NT seq  +upstreamnt  +downstreamnt
atggatctgatccgtaacaagcccctggacgaagcgctggcaatcctgcagtacaccccg
aaggccgcttgtgagccccttctgaagctggtgaagtctgcagccgcaaatgcggaaaac
aacttcaatatggacaagaacaacctctacgtcgccgagtgctacgtctgccccggcccg
acgctgaagcgcatgatgcctcgtgcacagggccgcggctaccgcatcctgaagcgcacc
agccacatgaccgttgttctgaaagagaaagagtaa

DBGET integrated database retrieval system