KEGG   Faecalibacterium prausnitzii L2-6: FP2_20600Help
Entry
FP2_20600         CDS       T02591                                 

Definition
(GenBank) acetyl-CoA acetyltransferases
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
fpr  Faecalibacterium prausnitzii L2-6
Pathway
fpr00071  Fatty acid degradation
fpr00072  Synthesis and degradation of ketone bodies
fpr00280  Valine, leucine and isoleucine degradation
fpr00310  Lysine degradation
fpr00362  Benzoate degradation
fpr00620  Pyruvate metabolism
fpr00630  Glyoxylate and dicarboxylate metabolism
fpr00640  Propanoate metabolism
fpr00650  Butanoate metabolism
fpr00900  Terpenoid backbone biosynthesis
fpr01100  Metabolic pathways
fpr01110  Biosynthesis of secondary metabolites
fpr01120  Microbial metabolism in diverse environments
fpr01130  Biosynthesis of antibiotics
fpr01200  Carbon metabolism
fpr01212  Fatty acid metabolism
fpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:fpr00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    FP2_20600
   00630 Glyoxylate and dicarboxylate metabolism
    FP2_20600
   00640 Propanoate metabolism
    FP2_20600
   00650 Butanoate metabolism
    FP2_20600
  Lipid metabolism
   00071 Fatty acid degradation
    FP2_20600
   00072 Synthesis and degradation of ketone bodies
    FP2_20600
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FP2_20600
   00310 Lysine degradation
    FP2_20600
   00380 Tryptophan metabolism
    FP2_20600
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    FP2_20600
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    FP2_20600
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    FP2_20600
Enzymes [BR:fpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     FP2_20600
Exosome [BR:fpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FP2_20600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBK99452
UniProt: D4JZK3
Position
complement(2077965..2079182)
Genome map
AA seq 405 aa AA seqDB search
MKKIVIASACRTAIGKFGGTLANVPAAELGSIVIKEALDRANVKPEQVDHVYMGCVIQAG
LGQNVARQASLKAGLPIETPAVTVNVVCGSGLNCVNMAAQMIEAGDADIVVAGGMENMDM
APFALQKARYGYRMGAPMGKSEIVDTMVNDALWDACGFNKHMGMTAENVCTNETYQKKYG
YSPITREMLDEFAYNSQLKADKAIKDGAFKDEIVPVVIKGKKGDTVFDTDEGPRLSAPEV
LAKLKPAFTKDGIVTAANSSAINDGAAALVIMSEEKAKELGVKPLATWVAGALAGVEPEV
MGLGPIAATKKVMAKTGLTVADMDLVEANEAFAAQSIAVGEALGFDKDKLNVNGGAIALG
HPVGASGARILVTLLYAMKHRGAHKGLATLCIGGGMGCATIVEMD
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatcgttatcgcatctgcttgccgtactgctattggtaagtttggcggcacc
ctggcaaacgtccctgctgcagagctgggctccatcgtcatcaaggaggccctggaccgt
gctaatgtgaaacccgagcaggtcgatcatgtttacatgggctgcgtcatccaggctggt
ctgggccagaacgtcgctcgtcaggcttccctgaaggctggcctgcccatcgagactcct
gctgtcaccgtcaacgtggtctgcggctccggtctgaactgcgtgaacatggctgctcag
atgatcgaggccggcgatgctgacatcgtggtcgcaggcggcatggagaacatggatatg
gctcccttcgcactgcagaaggctcgctacggctaccgcatgggcgctcccatgggcaag
agcgagatcgtggataccatggtcaacgatgctctgtgggacgcctgcggcttcaacaag
cacatgggcatgaccgctgagaacgtctgcaccaacgagacctatcagaagaagtacggc
tacagccccatcacccgcgagatgctggacgagttcgcttacaacagccagctgaaggct
gacaaggccatcaaggacggcgctttcaaggatgagatcgttccggttgtcatcaagggc
aagaagggcgataccgtgttcgataccgatgaaggcccccgtctgagcgctcccgaagtg
ctggcaaagctgaagcccgccttcaccaaggacggcatcgtcaccgctgcaaactcctcc
gctatcaacgatggcgcggctgctctggtcatcatgagcgaagagaaggccaaggagctg
ggcgtgaagcctctggctacctgggtcgcaggtgctctggcaggcgtcgagcctgaggtc
atgggtcttggccccatcgccgctaccaagaaggtcatggctaagaccggcctgaccgtt
gctgatatggatctggtcgaggccaacgaggcattcgcagcacagtccatcgcagtcggc
gaggctctgggcttcgataaggacaagctgaacgtcaacggcggcgcgatcgctctgggc
cacccggtcggcgcttccggtgctcgtatcctcgtcaccctgctgtacgctatgaagcat
cgtggtgctcacaagggtctggctaccctgtgcatcggcggcggcatgggctgcgcgacc
atcgtcgagatggactga

DBGET integrated database retrieval system