KEGG   Flavobacterium psychrophilum JIP02/86: FP0634Help
Entry
FP0634            CDS       T00548                                 

Gene name
folE1
Definition
(RefSeq) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00790  Folate biosynthesis
fps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fps00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FP0634 (folE1)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     FP0634 (folE1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-GeneID: 5299208
NCBI-ProteinID: YP_001295555
UniProt: A6GXB6
Position
830501..831172
Genome map
AA seq 223 aa AA seqDB search
MSILTDKEITEILGDNHQMTSANSPIRSDAFVKTDDQKMQNIEKHFYDIMQELGLDMTDD
SLQGTPHRVAKMFIQEIFSGLDPKNKPTISTFDNEYHYDKMLVEANISFNSTCEHHFLPI
FGKAHIGYISSGKVIGLSKLNRIVDYFSRRPQVQERLIMQIFNDLKIALNTENVIVVMEA
KHLCVSSRGIKHESSFTSTIQYGGIFNEKENRNDFFNMINSEK
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgagtatattgactgataaagaaataactgagattttaggcgataaccaccagatgact
tctgccaactctccaatacgttcagatgcttttgtaaaaacagatgatcagaaaatgcaa
aatatcgaaaagcatttttatgatattatgcaagaattaggactcgatatgactgatgat
agcttgcaaggaacaccacatcgtgttgcaaaaatgtttatacaagaaatttttagtggc
ttagatccaaaaaataagcctaccatttctactttcgataatgaatatcattatgataaa
atgttagttgaagccaatattagcttcaattctacttgcgaacatcattttttgcccata
tttggtaaagctcatataggttatatttctagcggaaaagttatcggattatcaaaatta
aataggattgtagattatttttctcgtcgtccgcaagttcaggaacgattaattatgcaa
atttttaatgatttaaaaatagctttaaataccgaaaacgtaattgtagttatggaagcc
aaacatttatgtgtttccagtcgtggaattaagcatgaatctagttttacatcgaccata
cagtatggcgggatttttaatgaaaaagaaaatagaaatgatttttttaatatgataaat
tctgaaaaataa

DBGET integrated database retrieval system