KEGG   Flavobacterium psychrophilum JIP02/86: FP0895Help
Entry
FP0895            CDS       T00548                                 

Gene name
thrS
Definition
(RefSeq) Threonine--tRNA ligase
  KO
K01868  threonyl-tRNA synthetase [EC:6.1.1.3]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00970  Aminoacyl-tRNA biosynthesis
Module
fps_M00360  Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:fps00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    FP0895 (thrS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fps01007]
    FP0895 (thrS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:fps03016]
    FP0895 (thrS)
Enzymes [BR:fps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.3  threonine---tRNA ligase
     FP0895 (thrS)
Amino acid related enzymes [BR:fps01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   FP0895 (thrS)
Transfer RNA biogenesis [BR:fps03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    FP0895 (thrS)
 Prokaryotic Type
    FP0895 (thrS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b HGTP_anticodon tRNA_SAD TGS B_lectin
Motif
Other DBs
NCBI-GeneID: 5298926
NCBI-ProteinID: YP_001295811
UniProt: A6GY22
Position
complement(1110660..1112606)
Genome map
AA seq 648 aa AA seqDB search
MIKITLPDGSIKEFENGVTPMDVAKSISEGLARNVISAAFNNITVEISTELTTDGSLVLY
TWNDKDGKKAFWHSTSHVMAQVLEEMYPGLKLTLGPAIDNGFYYDVDFGDTKIVEADFKK
IESRILEISKEKHEFKLRPVTKADALELYKDNEYKFELISNLEDGTITFCDHATFTDLCR
GGHIPNTGIIKAVKIMSIAGAYWRGDEKNKQLTRVYGTSFPKQKDLTDYLELLEEAKRRD
HRKLGKELELFAFSQKVGQGLPLWLPKGAALRDRLEQFLKKAQKKGGYEQVVTPHIGQKE
LYVTSGHYAKYGADSFQPISTPTEGEEFLLKPMNCPHHCEIYNVRPWSYKDLPKRYAEFG
TVYRYEQSGELHGLTRVRGFTQDDAHIFCTPDQLDEEFKKVIDLVLYVFGSLGFENFTAQ
ISLRDKENRDKYIGSDENWEKAENAIINAARDKNLNTVVEYGEAAFYGPKLDFMVKDALG
RSWQLGTIQVDYNLPERFELTYKGSDDQLHRPVMIHRAPFGSMERFIAILLEHTAGNFPL
WLMPEQAIILCLSDKYEIYAKKVLNLLENHEIRALIDNRNESIGRKIRDAEMQKTPFMLI
VGEEEEKNNTISIRRHGQEGKGNITVTIEEFARIVNDEISKTLKTFEV
NT seq 1947 nt NT seq  +upstreamnt  +downstreamnt
atgattaagattacattacctgatggttcgattaaagagtttgagaatggcgtaactcct
atggatgttgctaaaagtattagtgaaggtttggctagaaatgtgatttcggcagctttt
aataatattacggtggagatttcgacggaattgaccacggatggttctcttgttttgtat
acttggaatgataaggacggaaagaaggctttttggcattcgacttcgcatgtcatggcg
caagttttggaggagatgtatcctggtttgaagttgactcttggtcctgcaatagataat
ggtttttattatgatgtagattttggtgatactaaaattgtggaagctgattttaagaaa
atagagagtcgtattttagagatttcgaaagaaaaacatgagtttaaattgcgtcctgtt
actaaggctgatgctttggaactttataaagataatgaatataagttcgagttgatttcg
aatctggaagatggtacgattactttttgtgatcatgctacttttaccgatttgtgtcgt
ggtgggcatattccgaatactgggattataaaagctgtaaagatcatgagtattgctggt
gcttactggcgtggcgatgaaaaaaacaagcaattgactcgagtttacggaacttcgttt
ccaaaacaaaaagatctgactgattatttagagttactggaagaggcaaaacgtcgtgat
catagaaaattaggtaaagaattagaattatttgctttttcacagaaagttggtcaaggt
ttgcctttgtggttgcctaagggtgctgctttgcgtgatcgcttggagcagtttttgaaa
aaagctcagaaaaaaggtggttacgagcaagtggtgactccgcatattgggcagaaagaa
ttgtatgttacttctggtcattatgcaaaatatggagctgatagttttcaacctatttcg
actcctaccgaaggtgaagagtttttattgaaacctatgaactgcccgcaccactgtgaa
atatataatgtaagaccttggtcttataaggatttgcccaagcgttatgctgaatttggt
accgtatatagatatgaacaaagtggagaattgcacggtttaactcgtgttcgtggattt
acacaagatgatgcgcatattttttgtacaccagatcagttagatgaggaatttaaaaaa
gtaattgacctagtattatatgtgtttggttcgttaggatttgaaaatttcacagctcaa
atatcattaagagacaaagaaaatagagataagtatataggtagcgacgaaaattgggaa
aaagctgaaaatgcgattatcaatgcggcacgtgataaaaatttgaatactgttgtagaa
tatggtgaagcggctttttatggtcctaagcttgactttatggttaaagatgctttgggt
agaagctggcaattaggaaccattcaggtagattacaacttacccgaacgcttcgaattg
acctacaaaggttctgatgatcagttacacagacctgtaatgattcaccgtgctcctttt
ggttcgatggaacgatttatagccattttattagaacatacagcaggaaatttccccctt
tggctcatgccagaacaagctataatattgtgtttgagtgataaatatgaaatatatgcg
aaaaaagttttaaatctgctagaaaatcacgaaattcgcgccctaattgataacagaaac
gaatcgattggaagaaaaattagagatgcagaaatgcaaaaaaccccgtttatgctgatt
gtaggcgaggaagaagagaaaaataataccatttctatacgccgtcatgggcaagaagga
aaaggaaatattacggttacaatagaagaatttgctagaattgtaaacgacgaaataagc
aaaacattaaaaacatttgaagtttaa

DBGET integrated database retrieval system