KEGG   Flavobacterium psychrophilum JIP02/86: FP0957Help
Entry
FP0957            CDS       T00548                                 

Gene name
hisB
Definition
(RefSeq) Histidine biosynthesis bifunctional protein HisB [Includes: Histidinol-phosphatase; Imidazoleglycerol-phosphate dehydratase (IGPD)]
  KO
K01089  imidazoleglycerol-phosphate dehydratase / histidinol-phosphatase [EC:4.2.1.19 3.1.3.15]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00340  Histidine metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01230  Biosynthesis of amino acids
Module
fps_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    FP0957 (hisB)
Enzymes [BR:fps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.15  histidinol-phosphatase
     FP0957 (hisB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.19  imidazoleglycerol-phosphate dehydratase
     FP0957 (hisB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPD PNK3P Hydrolase_like
Motif
Other DBs
NCBI-GeneID: 5298958
NCBI-ProteinID: YP_001295865
UniProt: A6GY78
Position
1250147..1251283
Genome map
AA seq 378 aa AA seqDB search
MKKKVLFIDRDGTMIKETIDEQIDGFDKMIFYPKCIPFLSKIAQELNYELVMITNQDGLG
TASFPEETFWPVHNFIMKTFENEGVIFNKVCIDRTFPSENANTRKPKTGLLTNYFSDDYD
LQNSFVIGDRLTDVELGKNLGSKAIFINDNTNLGTGEISVKKEELNPYIALETNDWQKIY
EFLKLENRRASIVRKTNETDISILLNLDGTGKSNINTGIAFFDHMLDQIARHGQMDLEIL
VKGDLQVDEHHTIEDTAIALGEVFAQALGNKLGIERYGFCLPMDDCLAQVAIDFGGRNWL
VWEANFKREMIGQMPTEMFFHFFKSFSDGAKANLNIKAEGTNEHHKIEAIFKAFAKAIKA
AVKRDSEKMILPSTKGML
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaagtattatttatagatcgtgatggcacgatgataaaagaaacaatcgat
gagcaaatagatggtttcgataaaatgattttttatccaaaatgtattccttttttgagc
aaaattgcacaagaattaaattacgaattggtgatgattaccaatcaagacggcttggga
acggctagttttcctgaagaaactttttggccggtacacaattttattatgaaaaccttc
gaaaatgaaggtgtaattttcaataaagtgtgcattgacagaacatttccttcagagaat
gccaatactagaaaaccaaaaactggcttgctaactaactatttttctgatgattatgat
ttacaaaattcatttgtaattggagaccgattaacggatgtcgaattagggaaaaacctc
ggttcaaaagcaatttttatcaatgataatactaatttaggaacaggagaaatttcggta
aaaaaagaagaattaaacccatatattgctttagaaaccaatgattggcaaaaaatttat
gagttcttgaaactcgaaaatcgcagggcttctatcgttagaaaaaccaacgaaaccgat
atttctattctcttaaatctcgatggaactggtaaaagtaatattaataccggcatcgca
tttttcgaccacatgctagatcaaattgcacgccacggacaaatggatttggaaattctt
gtaaaaggtgatttgcaagttgacgaacaccacaccattgaagacacagccattgcttta
ggagaagtttttgcacaagccctaggaaacaaattaggaatagaacgctacggattttgt
ttaccaatggacgattgtttggcgcaagtagcgatcgattttggcggacgaaattggttg
gtttgggaagccaattttaaacgggaaatgattggacaaatgcctaccgaaatgtttttt
cacttctttaaatctttctctgacggcgcaaaagccaatctaaatattaaggccgaaggt
accaatgagcaccataaaattgaagctatttttaaagcttttgccaaagccataaaagca
gctgtaaaacgagactcagaaaaaatgattttaccaagcacaaaaggaatgctttaa

DBGET integrated database retrieval system