KEGG   Flavobacterium psychrophilum JIP02/86: FP0958Help
Entry
FP0958            CDS       T00548                                 

Gene name
hisC
Definition
(RefSeq) Histidinol-phosphate transaminase
  KO
K00817  histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00340  Histidine metabolism
fps00350  Tyrosine metabolism
fps00360  Phenylalanine metabolism
fps00400  Phenylalanine, tyrosine and tryptophan biosynthesis
fps00401  Novobiocin biosynthesis
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01130  Biosynthesis of antibiotics
fps01230  Biosynthesis of amino acids
Module
fps_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    FP0958 (hisC)
   00350 Tyrosine metabolism
    FP0958 (hisC)
   00360 Phenylalanine metabolism
    FP0958 (hisC)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    FP0958 (hisC)
  09110 Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    FP0958 (hisC)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:fps01007]
    FP0958 (hisC)
Enzymes [BR:fps01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     FP0958 (hisC)
Amino acid related enzymes [BR:fps01007]
 Aminotransferase (transaminase)
  Class II
   FP0958 (hisC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5 Alliinase_C Baculo_p74 RNase_Zc3h12a
Motif
Other DBs
NCBI-GeneID: 5299622
NCBI-ProteinID: YP_001295866
UniProt: A6GY79
Position
1249107..1250147
Genome map
AA seq 346 aa AA seqDB search
MNNFNINNLVRENIKNMQAYASARDEFKDFTHNMVYLDANENPFSNGINRYPDPQQKKLK
GFLAQQNKINENQMLLGNGSDEVLDLVFRAFCEPNVDNVITLPPTYGMYGVLANINAIEN
KEVLLSANFQPNINEILKNINENTKIIFLCSPNNPTGNSFDDQAVLTLLKNFNGLVVIDE
AYIDFSKNGSWLHVISDYPNLLITQTLSKAYAMAGLRIGILYASAAIISILNKIKPPYNI
NNLSQESALKKLEQSTLNFHVKKIINERKKMVQSLISIPFIEKIYPSDANFILIKVEDAN
KRYNQLIEKGIVIRNRSNQPLCENCLRITIGTKEENEKLITVLKAL
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttcaatatcaataatctcgttagagaaaatataaaaaatatgcaagcgtat
gcttctgcacgagatgaatttaaagattttacgcacaatatggtttatcttgatgccaat
gaaaatccgttttctaatggaattaatcgatatccagatccgcaacaaaaaaaattgaaa
ggttttttagcacagcaaaacaagatcaatgaaaatcaaatgctattaggaaatggaagc
gacgaagtactagatttagtattcagagccttttgtgaacccaatgtagacaatgtaatt
acgcttccgccaacgtacggaatgtatggcgttttggctaatattaatgctatcgaaaac
aaagaagttttattatctgctaattttcaacctaatattaatgaaatactaaagaatata
aatgagaatactaaaattattttcctttgttcgcccaataatccaacaggaaattctttt
gatgaccaagctgttttaaccttgctaaaaaactttaacggattagtagttattgatgaa
gcctatatcgatttttctaaaaatggcagttggttgcacgtaataagcgattatccaaat
cttcttattacacaaacactttctaaagcgtatgccatggcaggtttaagaataggaatt
ttatatgcttctgcagctataatttcgatattaaataagataaaaccaccgtataacatc
aataatttatcacaagaatcggctttaaaaaaactagaacaaagtaccttaaatttccat
gtcaaaaaaattataaatgagcgaaaaaaaatggttcaatctttaatttctataccattt
atagaaaaaatatacccttcggatgctaattttattctgataaaagtagaggatgccaac
aaaagatacaaccagctaatcgaaaaaggaatcgtcattagaaacagaagcaatcagcct
ttgtgcgaaaattgtttgagaattacgattggaaccaaagaagaaaacgaaaaattaata
acagttttaaaagcattataa

DBGET integrated database retrieval system