KEGG   Flavobacterium psychrophilum JIP02/86: FP0965Help
Entry
FP0965            CDS       T00548                                 

Definition
(RefSeq) Probable DNA polymerase III subunit
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00230  Purine metabolism
fps00240  Pyrimidine metabolism
fps01100  Metabolic pathways
fps03030  DNA replication
fps03430  Mismatch repair
fps03440  Homologous recombination
Module
fps_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    FP0965
   00240 Pyrimidine metabolism
    FP0965
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    FP0965
   03430 Mismatch repair
    FP0965
   03440 Homologous recombination
    FP0965
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fps03032]
    FP0965
   03400 DNA repair and recombination proteins [BR:fps03400]
    FP0965
Enzymes [BR:fps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     FP0965
DNA replication proteins [BR:fps03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     FP0965
DNA repair and recombination proteins [BR:fps03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     FP0965
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_delta2 AAA RuvB_N AAA_22 AAA_14 AAA_16 AAA_5 TIP49 DNA_pol3_gamma3 Rad17 AAA_30 ResIII NTPase_1 AAA_18 AAA_24 RNA_helicase DNA_pol3_delta T2SSE DUF815 Mg_chelatase NACHT AAA_assoc_2 DEAD Sigma54_activ_2 AAA_28 TsaE Sigma54_activat dNK AAA_2
Motif
Other DBs
NCBI-GeneID: 5300067
NCBI-ProteinID: YP_001295873
UniProt: A6GY86
Position
complement(1239309..1240394)
Genome map
AA seq 361 aa AA seqDB search
MEQFVVSARKYRPQTFKDVVGQQAITNTLLNAIETNHLASALLFTGPRGVGKTTCARILA
RKINQPGYDDPNEDFAFNVFELDAASNNSVDDIRNLIDQVRIPPQTGQYKVYIIDEVHML
SSAAFNAFLKTLEEPPKHAIFILATTEKHKIIPTILSRCQIFDFKRITVKDAKEHLAEVA
TNQGVIFEDDALHIIAQKADGAMRDALSIFDRVVSFCGKNLTRQAVTENLNVLDYETYIN
VTNLILENKIPELLLAYNDILAKGFDGHHFVAGLASHFRDLLVSKTPATITLLEVGEQAQ
KMYYVQSQKASQDFLLQGIDLANDCDLKFKLSQNQRLLVELCLMQLASITFDGEKKKLNN
I
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggaacaatttgtagtatcggctcgtaaatatcgtccgcaaacgtttaaagacgtggtg
gggcaacaagccattaccaatacgttactaaatgcgatagaaacaaatcatttggcatca
gccctattatttactggtcctcgtggcgtaggaaaaacaacttgtgccagaattttagcc
agaaaaataaaccaaccaggttacgacgacccgaacgaagattttgctttcaatgttttc
gaactcgatgcggcttcaaacaattcggtcgatgatattcgtaatctaatcgatcaagtt
cgtatccccccacaaacgggacaatataaagtttatattatcgatgaggttcacatgtta
tcatctgcagcatttaatgcttttttgaaaacattagaagaaccaccaaaacatgccatt
tttattttggcaacgaccgaaaaacataaaattattccaacgatattatctcgttgtcag
atattcgatttcaaaagaattactgtaaaagatgccaaggaacatctcgccgaagtagct
accaatcaaggtgtcattttcgaagacgatgctttgcatattattgcccaaaaagcagat
ggtgccatgcgcgatgctttgtctatttttgatagagttgtgtctttttgtggaaaaaac
ctaacacgacaagcagttaccgaaaacttgaatgtgctagattatgaaacctatattaat
gtaacgaatttaattttagaaaataaaattccagaattactattggcttacaacgatatt
ttggcaaaaggtttcgatgggcatcattttgtagctggattggcttcgcattttagagat
ttgttggttagcaaaacccctgcaactatcactttactagaagttggcgagcaagctcaa
aaaatgtattatgtacaatctcaaaaagcttcacaagattttctgttacaaggaatcgat
ttggctaatgattgtgatttaaaatttaagctttctcaaaaccagcgattactagtagaa
ctttgtttgatgcaactagcctctatcacttttgatggagaaaaaaaaaagctaaacaat
atataa

DBGET integrated database retrieval system