KEGG   Flavobacterium psychrophilum JIP02/86: FP0972Help
Entry
FP0972            CDS       T00548                                 

Gene name
sucD
Definition
(RefSeq) Succinyl-CoA synthetase, alpha subunit
  KO
K01902  succinyl-CoA synthetase alpha subunit [EC:6.2.1.5]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Pathway
fps00020  Citrate cycle (TCA cycle)
fps00640  Propanoate metabolism
fps00660  C5-Branched dibasic acid metabolism
fps01100  Metabolic pathways
fps01110  Biosynthesis of secondary metabolites
fps01120  Microbial metabolism in diverse environments
fps01130  Biosynthesis of antibiotics
fps01200  Carbon metabolism
Module
fps_M00009  Citrate cycle (TCA cycle, Krebs cycle)
fps_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:fps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    FP0972 (sucD)
   00640 Propanoate metabolism
    FP0972 (sucD)
   00660 C5-Branched dibasic acid metabolism
    FP0972 (sucD)
Enzymes [BR:fps01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     FP0972 (sucD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_binding Ligase_CoA Succ_CoA_lig CoA_binding_2 IlvN
Motif
Other DBs
NCBI-GeneID: 5299282
NCBI-ProteinID: YP_001295879
UniProt: A6GY93
Position
1232527..1233399
Genome map
AA seq 290 aa AA seqDB search
MSVLVNKDSKIIVQGFTGSEGTFHAEQMIEYGTNVVGGVTPGKGGTMHLDRPVFNTVKDA
VEKAGADTTIIFVPPAFAADAIMEAADAGIKVIIAITEGIPVADMIKANDYIKGKNCRLI
GPNCPGIITPGEAKVGIMPGFVFKKGNVGIVSKSGTLTYEAADQVVKQGLGITTAIGIGG
DPIIGTTTKEAVELLMNDPETHCIVMIGEIGGQLEADAAKWVRADGNRKPVVGFIAGVTA
PAGRTMGHAGAIVGGEDDTAEAKKRILRENGIHVVDSPAEIGKKVKEVLG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgagtgttttagttaataaagattcaaaaataatagttcaaggatttacgggaagcgaa
ggaactttccatgctgagcaaatgatcgaatacggtacaaacgttgtaggaggcgtaact
ccaggaaaaggaggaacaatgcacttagaccgtcccgtttttaatactgtaaaagatgca
gtagaaaaagcaggagcagatacaaccattatttttgtaccaccagcttttgctgctgat
gctattatggaagctgccgatgcaggtatcaaagtaattattgcaattacagaaggtatt
cctgttgcagatatgataaaagcaaatgattatatcaaaggcaaaaactgccgactaata
ggaccaaactgtccgggtattataaccccaggtgaagctaaagttggtatcatgccaggt
tttgtcttcaaaaaaggaaatgtaggaattgtttctaaatcaggaacattaacctacgaa
gctgctgaccaagtagtaaaacaaggtctaggaataactaccgcaatcggaattggagga
gatccaattattggaactacaacaaaagaagcagttgaattactaatgaatgatccagaa
actcattgcatcgtaatgattggtgaaattggaggacaactagaagctgatgccgctaaa
tgggtacgtgcagacggaaaccgcaaaccagtagttggctttattgcaggagttaccgct
ccagcaggaagaacaatggggcacgcaggtgcaattgtgggtggtgaagacgataccgcg
gaagctaaaaaacgcattttacgtgaaaacggaattcatgtagtagattctccagcagaa
attggtaaaaaagtaaaagaagttttaggataa

DBGET integrated database retrieval system