KEGG   Flavobacterium psychrophilum JIP02/86: FP0975Help
Entry
FP0975            CDS       T00548                                 

Gene name
efp
Definition
(RefSeq) Elongation factor P (EF-P)
  KO
K02356  elongation factor P
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
KEGG Orthology (KO) [BR:fps00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:fps03012]
    FP0975 (efp)
Translation factors [BR:fps03012]
 Prokaryotic Type
  Elongation factors
   FP0975 (efp)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Elong-fact-P_C EFP_N EFP
Motif
Other DBs
NCBI-GeneID: 5300360
NCBI-ProteinID: YP_001295882
UniProt: A6GY96
Position
1230579..1231142
Genome map
AA seq 187 aa AA seqDB search
MASTSDIRNGLCIKFNHDIYKIIEFLHVKPGKGPAFVRTKLRSLSNGKVLDNTFSAGHKI
DEVRVETHTYQYLYAEGDQFHFMNIESFEQITLDKKILDNPGLLKEGTNVMVQVNTETDL
PLSVDMPASIILEVTYAEPGVKGNTATNATKSATVETGASINVPLFINEGDKIKIDTASG
SYMERVK
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcatctacatcagatataagaaacggattgtgtatcaaatttaaccacgatatttat
aaaataatcgaatttcttcacgtaaaaccaggtaaaggaccagcattcgtacgtacaaaa
ttacgaagcttatctaacggaaaagtattagacaataccttttcggcaggacataaaata
gacgaagttcgtgtagaaacacatacttatcagtatttatacgccgaaggcgatcaattt
cattttatgaatatcgaatctttcgaacaaattactttagacaaaaaaatccttgataat
ccaggattacttaaagaaggaacaaacgtaatggtacaagtaaataccgaaaccgatttg
cctctttctgtagatatgccagcttcaataatattagaagttacgtatgctgagccaggt
gtaaaaggaaatactgctacaaacgcaacaaaatctgcaacggtagaaactggtgcctcc
ataaatgtacctttatttattaatgaaggtgataaaataaaaattgatactgcttcaggt
tcttatatggaacgtgtaaaataa

DBGET integrated database retrieval system