KEGG   Flavobacterium psychrophilum JIP02/86: FP0982Help
Entry
FP0982            CDS       T00548                                 

Definition
(RefSeq) Probable ATP-dependent exodeoxyribonuclease
  KO
K01144  exodeoxyribonuclease V [EC:3.1.11.5]
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
KEGG Orthology (KO) [BR:fps00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FP0982
Enzymes [BR:fps01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     FP0982
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 UvrD_C_2 AAA_19 PIF1 Viral_helicase1 UvrD_C ResIII AAA_14 AAA_11 NB-ARC ATPase_2 AAA AAA_22 DUF2075 T2SSE TsaE Helicase_RecD Flavi_DEAD TrwB_AAD_bind AAA_16 RsgA_GTPase SRP54 Torsin cobW
Motif
Other DBs
NCBI-GeneID: 5300842
NCBI-ProteinID: YP_001295889
UniProt: A6GYA3
Position
1222699..1224123
Genome map
AA seq 474 aa AA seqDB search
MSASLFYNVLQKKFPFNPTIKQDIFFQQIAEFVTNNTKDQIFVLKGYAGTGKTTVISTIV
NNLIEINKKYVLLAPTGRAAKVIANYSNKPAFTIHKNIYFPKKSSGGGVSFTLQPNKHKN
TIFFIDESSMISDVNTESKLYENGSLLDDLISYVYSGDNCKMILLGDTAQLPPVQLDISP
ALDTDTLSLHYNKDVYSIEFDEVMRQEENSGILYNATELRELLKDVFFNSFKFNLKGFKD
IIRLSDGYDIQDAINTAYSNYSIEDTAFIVRSNKRANQYNQQIRTKILDKESELSTGDFL
MVVKNNYFWLKDSDQAGFIANGDIIEVLDIRNIKELYGFKFANVKIRMVDYPDQKPYETV
LLLDTITSESPSLSYEESNKLYEEVIKDYENETTKYKKFQKVKENEYFNALQVKFSYAIT
CHKSQGGQWNTVFIEQPYLPNGIDKDYIRWLYTAMTRAKDKLYLIGFKDENFVN
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcttctttgttttacaatgttttacaaaaaaaatttccttttaaccccacaata
aaacaagatattttctttcagcaaatagcagaatttgttacaaacaatactaaagaccaa
atttttgtactaaaagggtatgcgggaacgggaaaaacaaccgtcatatctaccattgta
aataacttaatcgagattaataaaaagtatgtcttacttgccccaacaggtcgtgccgca
aaagtaattgctaattattcgaacaagccagcctttaccattcacaaaaatatatatttt
cctaaaaagtcatctggcggaggggtttcttttactttacagcccaacaaacataagaac
actattttttttatagatgaatcttcaatgatttctgatgtgaataccgaatctaaatta
tacgaaaacggatcccttttagatgatttaatttcctatgtatattcgggcgataactgc
aaaatgattctgttaggtgacacagcacaattaccaccagttcagttagatatatcgcca
gctttagatacagatactttgagtttacattacaataaagacgtgtattctatcgagttt
gatgaagtcatgcgacaggaagaaaactcaggaattttgtacaatgccacagaacttcga
gaattattaaaagatgtattttttaacagtttcaaatttaatctcaaaggattcaaagac
atcattcgcttatcagatggttacgatattcaagacgccattaacacagcatatagcaat
tatagtatagaagatacagcatttatagtccgatcaaacaaacgagccaaccagtacaat
cagcaaattagaacaaaaattctagacaaagaaagcgaactctctactggagatttccta
atggttgtaaaaaacaactacttttggttaaaagattccgaccaagcaggttttattgcc
aatggcgatattatcgaagtattagatataagaaatatcaaagaattatatggtttcaaa
tttgccaatgtaaaaattagaatggtcgattatcctgaccaaaaaccctatgaaaccgtt
ctattgttagacaccattaccagcgaatcaccatcattatcctacgaagaatcaaacaaa
ttgtacgaagaagtcatcaaagattatgaaaatgaaaccactaaatacaaaaagttccaa
aaagtaaaagaaaatgaatatttcaatgccctgcaagtcaaattctcgtatgccataacc
tgccacaaatcgcaaggcggacaatggaataccgtatttatcgagcaaccatatttgccc
aacggaatcgataaagattacattcgctggttatataccgccatgacaagagcaaaagac
aagttatatttaataggctttaaagacgaaaattttgtaaactaa

DBGET integrated database retrieval system