KEGG   Flavobacterium psychrophilum JIP02/86: FP0989Help
Entry
FP0989            CDS       T00548                                 

Definition
(RefSeq) Protein of unknown function precursor
Organism
fps  Flavobacterium psychrophilum JIP02/86
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DLH Hydrolase_4 Abhydrolase_5 BAAT_C Abhydrolase_7 Abhydrolase_3 Peptidase_S9 Lipase_3
Motif
Other DBs
NCBI-GeneID: 5300503
NCBI-ProteinID: YP_001295896
UniProt: A6GYB0
Position
1212645..1213622
Genome map
AA seq 325 aa AA seqDB search
MKKILLIMLLISKNYAIAQKTPEDFGYKQMSFKFQDDKVDLIVISKKGEEKIAKPLFFFC
QGSLPRPVVIYDEKGLYGTLPFNETPFLDDFHIIIIAKPAIPIIANANILGKNFMYLKDK
ENEIPPKGYTDRNYLDYYVFRNNFILKQLSKERWVSKKKLVVAGHSEGSSIASKMAILYP
KITHLIYSGGNPFGRIVNILSEERDKENTINYWKTVVENSAVINYNGGDTYKATYSFSLP
QRQNLVQLKIPILVTYGSKDVAANYNDLFQIEIIRDRKQNFKFINYPDLEHNFFAVNEKL
EPIYEKENWDKVAKDWLDWLHNSTN
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaatactgctaattatgctcttaatttcaaaaaattacgccattgctcaaaaa
actccagaagattttgggtacaaacaaatgtcattcaaatttcaagatgataaagtagat
ttgattgttatttctaaaaaaggagaagaaaaaatagccaaaccattgttctttttttgc
caaggaagtttgccaagacctgttgttatttatgacgaaaaaggattgtatggtactttg
ccttttaacgaaactccttttttagatgattttcatatcataattattgcaaaaccagct
attccaattattgcaaatgctaacatcttgggcaaaaattttatgtatttgaaagacaaa
gaaaatgaaattccacccaaaggttataccgataggaattatctagattattatgttttt
aggaacaatttcattcttaaacaattaagtaaagagcgatgggttagtaagaaaaagctt
gttgttgctgggcattctgaaggaagttctattgcttcaaaaatggcgattttatatcct
aaaataacgcatctcatttattctggagggaatccttttggtcgaattgtaaatatttta
tcagaagaaagggataaagaaaacaccataaattattggaaaacggtagtcgaaaacagt
gctgttatcaattataatggcggtgatacttataaagctacttatagtttttcgttgcca
caaaggcaaaatttagtacaacttaaaattccaattttagtgacttatggctcaaaagat
gtggcagcaaactacaacgatttatttcaaatagaaattattcgtgaccgaaaacagaat
ttcaaatttataaattatcctgatttagaacataattttttcgctgtaaatgaaaaatta
gaacctatttatgagaaagagaattgggataaagtggcaaaagactggttagactggtta
cataattcaacaaattaa

DBGET integrated database retrieval system