KEGG   Flavobacterium psychrophilum JIP02/86: FP1000Help
Entry
FP1000            CDS       T00548                                 

Definition
(RefSeq) Phosphate transporter family protein
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
fps  Flavobacterium psychrophilum JIP02/86
Brite
KEGG Orthology (KO) [BR:fps00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    FP1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-GeneID: 5299062
NCBI-ProteinID: YP_001295905
UniProt: A6GYC1
Position
1201324..1202766
Genome map
AA seq 480 aa AA seqDB search
MEFTLLIVIIIIALLFDLVNGFHDAANSIATVVSTKVLTPGQAVVWAAFFNVLAFWIFDM
SVGNTVAKTVDNGAINLWVIFSGLIAATIWNLATWKLGIPSSSSHTLIGGFAGAAVAHAG
FDVVNSSEILKVVAFIFLAPVIGGVISYIITIITIQRNPYKKIGSFTVLSIGVMYLMNYM
VNYMDVKPVMMWIVGGMLGIMILFYVWYYVVHGKSQTVLKESNMYKKLQLLSSAAFSLGH
GGADSQKVMGIICAACMVYANIAREKGTDKFIDKNFQVTELMQIEYETPDGKKEKFKPEH
KNGDKIFVYTKGKDIIDVITNQVIFEDKKLNTAYAESAQFTDYVVAGKLKEGYKVKTKVH
SDSMPWWIAFGCYLMIGLGTLMGGWKIVKTMGTKITKVTPLEGVCAETAGALTLFTVSNM
GIPVSTTHTITGSIIGVGATKRLSAVRWGVTISLLWAWILTIPVSATIAAIVYYITTIFI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatttacgctacttattgtaattattataattgcactattatttgatttggttaac
ggttttcacgatgcagcaaattctatcgcaacagttgtttctactaaggttttaacccca
ggacaagccgttgtttgggctgccttttttaatgtacttgccttttggatatttgacatg
agtgttggaaatacagttgcaaaaactgtagacaatggagccataaacctttgggtaata
ttttccggattaatagctgcaactatctggaatttagccacttggaaactaggaataccc
tcatcttcatcacatacccttattggaggatttgcaggggcagctgttgctcacgcaggt
tttgacgttgtaaactcttcagaaatactaaaagtagttgcttttatatttctagcacca
gttattgggggagtcatttcatatatcattaccatcatcacaatacaaagaaatccttat
aaaaagataggttcatttacagtactttcaataggagttatgtatttaatgaattatatg
gtaaattatatggatgttaaacctgttatgatgtggattgtaggtggcatgttagggatt
atgattcttttttatgtttggtactatgtagttcacggaaaaagccaaacagttctaaaa
gaatctaacatgtacaaaaaactacaattattatcatctgcagcattttcgttaggtcat
ggtggcgcagattcgcaaaaagtaatgggtattatttgtgccgcttgtatggtttacgct
aatattgctagagaaaaaggaaccgataagtttatagataaaaattttcaggttactgaa
ttaatgcaaattgagtacgaaacccctgatggtaaaaaagaaaaatttaagccagagcat
aaaaatggagataaaatatttgtttatacaaaaggaaaagacatcatagatgtaataaca
aatcaagttatttttgaagataaaaaactaaacacagcctatgcagagtcagcacaattt
acagactatgtagttgctggaaaactaaaagaaggctacaaagtaaaaaccaaagtacat
tcagactcgatgccttggtggattgcttttggatgttatctcatgattggtctaggaaca
ttaatgggaggttggaaaattgtaaaaacaatgggaacaaaaataacaaaagtaacaccg
ctagaaggtgtttgtgcagaaactgcaggtgcattaaccttatttacggtctctaatatg
gggattcctgtttctactacacatactattactggatctataattggagttggcgccaca
aaacgacttagcgcagtacgttggggagttacaataagtttattatgggcttggatttta
acaatacctgtttcggcaactatagcagccattgtatattatatcacgacaatatttatt
taa

DBGET integrated database retrieval system